Home
FacebookTwitterSearchMenu
  • Subscribe
  • Subscribe
  • News
  • Features
  • Knowledge Library
  • Columns
  • Customs
  • Jobs
  • Directory
  • FX Rates
  • Contact us
    • Contact us
    • About Us
    • Advertise
    • Send us news
    • Editorial Guidelines

Customs - Tariff Book Last updated: 01 Jan 2020

SA Customs Tariff (Schedule 1 Part 1) Print

Section VI
Products of the Chemical or Allied Industries

Notes

1.

(A)

Goods (excluding radioactive ores) answering to a description in heading 28.44 or 28.45 are to be classified in those headings and in no other heading of this Schedule.

(B)

Subject to paragraph (A) above, goods answering to a description in heading 28.43, 28.46 or 28.52 are to be classified in those subheadings and in no other heading of this Section.

2.

Subject to Note 1 above, goods classifiable in heading 30.04, 30.05, 30.06, 32.12, 33.03, 33.04, 33.05, 33.06, 33.07, 35.06, 37.07 or 38.08 by reason of being put up in measured doses or for retail sale are to be classified in those headings and in no other heading of this Schedule.

3.

Goods put up in sets consisting of two or more separate constituents, some or all of which fall in this Section and are intended to be mixed together to obtain a product of Section VI or VII, are to be classified in the heading appropriate to that product, provided that the constituents are:

(a)

having regard to the manner in which they are put up, clearly identifiable as being intended to be used together without first being repacked;

(b)

presented together; and

(c)

identifiable, whether by their nature or by the relative proportions in which they are present, as being complementary one to another.

Chapter 28
Inorganic Chemicals; Organic or Inorganic Compounds of Precious Metals, of Rare-earth Metals, of Radioactive Elements or of Isotopes

Notes

1.

Except where the context otherwise requires, the headings of this Chapter apply only to:

(a)

separate chemical elements and separate chemically defined compounds, whether or not containing impurities;

(b)

the products mentioned in (a) above dissolved in water;

(c)

the products mentioned in (a) above dissolved in other solvents provided the solution constitutes a normal and necessary method of putting up these products adopted solely for reasons of safety or for transport and that the solvent does not render the product particularly suitable for specific use rather than for general use;

(d)

the products mentioned in (a), (b) or (c) above with an added stabiliser (including an anti-caking agent) necessary for their preservation or transport;

(e)

the products mentioned in (a), (b), (c) or (d) above with an added anti-dusting agent or a colouring substance added to facilitate their identification or for safety reasons, provided the additions do not render the product particularly suitable for specific use rather than for general use.

2.

In addition to dithionites and sulphoxylates, stabilised with organic substances (heading 28.31), carbonates and peroxocarbonates of inorganic bases (heading 28.36), cyanides, cyanide oxides and complex cyanides of inorganic bases (heading 28.37), fulminates, cyanates and thiocyanates, of inorganic bases (heading 28.42), organic products included in headings 28.43 to 28.46 and 28.52 and carbides (heading 28.49), only the following compounds of carbon are to be classified in this Chapter:

(a)

oxides of carbon, hydrogen cyanide and fulminic, isocyanic, thiocyanic and other simple or complex cyanogen acids (heading 28.11);

(b)

halide oxides of carbon (heading 28.12);

(c)

carbon disulphide (heading 28.13);

(d)

thiocarbonates, selenocarbonates, tellurocarbonates, selenocyanates, tellurocyanates, tetrathiocyanatodiamminochromates (reineckates) and other complex cyanates, of inorganic bases (heading 28.42);

(e)

hydrogen peroxide, solidified with urea (heading 28.47), carbon oxysulphide, thiocarbonyl halides, cyanogen, cyanogen halides and cyanamide and its metal derivatives (heading 28.53) (excluding calcium cyanamide, whether or not pure) (Chapter 31).

3.

Subject to the provisions of Note 1 to Section VI, this Chapter does not cover the following:

(a)

sodium chloride or magnesium oxide, whether or not pure, or other products of Section V;

(b)

organo-inorganic compounds (excluding those mentioned in Note 2 above);

(c)

products mentioned in Note 2, 3, 4 or 5 to Chapter 31;

(d)

inorganic products of a kind used as luminophores, of heading 32.06; glass frit and other glass in the form of powder, granules or flakes, of heading 32.07;

(e)

artificial graphite (heading 38.01); products put up as charges for fire-extinguishers or put up in fire-extinguishing grenades, of heading 38.13; ink removers put up in packings for retail sale, of heading 38.24; cultured crystals (excluding optical elements) weighing not less than 2,5 g each, of the halides of the alkali or alkaline-earth metals, of heading 38.24;

(f)

precious or semi-precious stones (natural, synthetic or reconstructed) or dust or powder of such stones (headings 71.02 to 71.05), or precious metals or precious metal alloys of Chapter 71;

(g)

the metals, whether or not pure, metal alloys or cermets, including sintered metal carbides (metal carbides sintered with a metal), of Section XV;or

(h)

optical elements, for example, of the halides of the alkali or alkaline-earth metals (heading 90.01).

4.

Chemically defined complex acids consisting of a non-metal acid of Sub-chapter II and a metal acid of Sub-chapter IV are to be classified in heading 28.11.

5.

Headings 28.26 to 28.42 apply only to metal or ammonium salts or peroxysalts. Except where the context otherwise requires, double or complex salts are to be classified in heading 28.42.

6.

Heading 28.44 applies only to:

(a)

technetium (atomic No. 43), promethium (atomic No. 61), polonium (atomic No. 84) and all elements with an atomic number greater than 84;

(b)

natural or artificial radioactive isotopes (including those of the precious metals or of the base metals of Section XIV and XV), whether or not mixed together;

(c)

compounds, inorganic or organic, of these elements or isotopes, whether or not chemically defined, whether or not mixed together;

(d)

alloys, dispersions (including cermets), ceramic products and mixtures containing these elements or isotopes or inorganic or organic compounds thereof and having a specific radioactivity exceeding 74 Bq/g (µ0,002 Ci/g);

(e)

spent (irradiated) fuel elements (cartridges) of nuclear reactors;

(f)

radioactive residues whether or not usable. The term "isotopes", for the purposes of this Note and of the wording of headings 28.44 and 28.45, refers to:

individual nuclides, excluding, however, those existing in nature in the monoisotopic state;

mixtures of isotopes of one and the same element, enriched in one or several of the said isotopes, that is, elements of which the natural isotopic composition has been artificially modified.

7.

Heading 28.53 includes copper phosphide (phosphor copper) containing more than 15 per cent by mass of phosphorus.

8.

Chemical elements (for example, silicon and selenium) doped for use in electronics are to be classified in this Chapter, provided that they are in forms unworked as drawn, or in the form of cylinders or rods. When cut in the form of discs, wafers or similar forms, they fall in heading 38.18.

Subheading Note

1.

For the purposes of subheading 2852.10, the expression "chemically defined" means all organic or inorganic compounds of mercury meeting the requirements of paragraphs (a) to (e) of Note 1 to Chapter 28 or paragraphs (a) to (h) of Note 1 to Chapter 29.

Chapter 1
Chemical Elements
HeadingCDDescriptionUnitGeneralEUEFTASADC
28.01Fluorine, chlorine, bromine and iodine:
2801.101- Chlorinekg10%freefreefree
2801.204- Iodinekgfreefreefreefree
2801.309- Fluorine; brominekgfreefreefreefree
2802.009Sulphur, sublimed or precipitated; colloidal sulphurkgfreefreefreefree
2803.002Carbon (carbon blacks and other forms of carbon not elsewhere specified or included)kg10%freefreefree
28.04Hydrogen, rare gases and other non-metals:
2804.100- Hydrogenm3/101.3kPfreefreefreefree
2804.2- Rare gases:
2804.211-- Argonm3/101.3kPfreefreefreefree
2804.292-- Otherm3/101.3kPfreefreefreefree
2804.308- Nitrogenm3/101.3kPfreefreefreefree
2804.404- Oxygenm3/101.3kPfreefreefreefree
2804.509- Boron; telluriumkgfreefreefreefree
2804.6- Silicon:
2804.616-- Containing by mass 99,99 per cent or more of siliconkgfreefreefreefree
2804.690-- Otherkgfreefreefreefree
2804.708- Phosphoruskgfreefreefreefree
2804.802- Arsenickgfreefreefreefree
2804.907- Seleniumkgfreefreefreefree
28.05Alkali or alkaline-earth metals; rare-earth metals, scandium and yttrium, whether or not intermixed or interalloyed; mercury:
2805.1- Alkali or alkaline-earth metals:
2805.110-- Sodiumkgfreefreefreefree
2805.127-- Calciumkgfreefreefreefree
2805.191-- Otherkgfreefreefreefree
2805.303- Rare-earth metals, scandium and yttrium, whether or not intermixed or interalloyedkgfreefreefreefree
2805.408- Mercurykgfreefreefreefree
Chapter 2
Inorganic Acids and Inorganic Oxygen Compounds of Non-metals
HeadingCDDescriptionUnitGeneralEUEFTASADC
28.06Hydrogen chloride (hydrochloric acid); chlorosulphuric acid:
2806.108- Hydrogen chloride (hydrochloric acid)kg10%freefreefree
2806.202- Chlorosulphuric acidkgfreefreefreefree
2807.007Sulphuric acid; oleumkgfreefreefreefree
2808.000Nitric acid; sulphonitric acidskgfreefreefreefree
28.09Diphosphorus pentaoxide; phosphoric acid; polyphosphoric acids, whether or not chemically defined:
2809.109- Diphosphorus pentaoxidekgfreefreefreefree
2809.20- Phosphoric acid and polyphosphoric acids:
2809.20.100-- Of a phosphorous content of 78 per cent or morekgfreefreefreefree
2809.20.909-- Otherkgfreefreefreefree
2810.004Oxides of boron; boric acidskgfreefreefreefree
28.11Other inorganic acids and other inorganic oxygen compounds of non-metals:
2811.1- Other inorganic acids:
2811.119-- Hydrogen fluoride (hydrofluoric acid)kgfreefreefreefree
2811.125-- Hydrogen cyanide (hydrocyanic acid)kgfreefreefreefree
2811.197-- Otherkgfreefreefreefree
2811.2- Other inorganic oxygen compounds of non-metals:
2811.213-- Carbon dioxidekgfreefreefreefree
2811.229-- Silicon dioxidekgfreefreefreefree
2811.294-- Otherkgfreefreefreefree
Chapter 3
Halogen or Sulphur Compounds, of Non-metals
HeadingCDDescriptionUnitGeneralEUEFTASADC
28.12Halides and halide oxides of non-metals:
2812.1- Chlorides and chloride oxides:
2812.112-- Carbonyl dichloride (phosgene)kgfreefreefreefree
2812.129-- Phosphorus oxychloridekgfreefreefreefree
2812.135-- Phosphorus trichloridekgfreefreefreefree
2812.141-- Phosphorus pentachloridekgfreefreefreefree
2812.158-- Sulphur monochloridekgfreefreefreefree
2812.164-- Sulphur dichloridekgfreefreefreefree
2812.170-- Thionyl chloridekgfreefreefreefree
2812.19-- Other:
2812.19.100--- Arsenic trichloridekgfreefreefreefree
2812.19.909--- Otherkgfreefreefreefree
2812.902- Otherkgfreefreefreefree
28.13Sulphides of non-metals; commercial phosphorus trisulphide:
2813.109- Carbon disulphidekgfreefreefreefree
2813.906- Otherkgfreefreefreefree
Chapter 4
Inorganic Bases and Oxides, Hydroxides and Peroxides of Metals
HeadingCDDescriptionUnitGeneralEUEFTASADC
28.14Ammonia, anhydrous or in aqueous solution:
2814.103- Anhydrous ammoniakgfreefreefreefree
2814.208- Ammonia in aqueous solutionkgfreefreefreefree
28.15Sodium hydroxide (caustic soda); potassium hydroxide (caustic potash); peroxides of sodium or potassium:
2815.1- Sodium hydroxide (caustic soda):
2815.113-- Solidkg20%20%20%free
2815.127-- In aqueous solution (soda lye or liquid soda)kg20%20%20%free
2815.201- Potassium hydroxide (caustic potash)kgfreefreefreefree
2815.306- Peroxides of sodium or potassiumkgfreefreefreefree
28.16Hydroxide and peroxide of magnesium; oxides, hydroxides and peroxides, of strontium or barium:
2816.100- Hydroxide and peroxide of magnesiumkgfreefreefreefree
2816.404- Oxides, hydroxides and peroxides, of strontium or bariumkgfreefreefreefree
2817.007Zinc oxide; zinc peroxidekgfreefreefreefree
28.18Artificial corundum, whether or not chemically defined; aluminium oxide; aluminium hydroxide:
2818.108- Artificial corundum, whether or not chemically definedkgfreefreefreefree
2818.202- Aluminium oxide other than artificial corundumkgfreefreefreefree
2818.307- Aluminium hydroxidekgfreefreefreefree
28.19Chromium oxides and hydroxides:
2819.101- Chromium trioxidekgfreefreefreefree
2819.908- Otherkgfreefreefreefree
28.20Manganese oxides:
2820.101- Manganese dioxidekgfreefreefreefree
2820.908- Otherkgfreefreefreefree
28.21Iron oxides and hydroxides; earth colours containing 70 per cent or more by mass of combined iron evaluated as Fe[2]O[3]:
2821.105- Iron oxides and hydroxideskgfreefreefreefree
2821.209- Earth colourskgfreefreefreefree
2822.004Cobalt oxides and hydroxides; commercial cobalt oxideskgfreefreefreefree
2823.008Titanium oxideskg10%freefreefree
28.24Lead oxides; red lead and orange lead:
2824.106- Lead monoxide (litharge, massicot)kgfreefreefreefree
2824.902- Otherkgfreefreefreefree
28.25Hydrazine and hydroxylamine and their inorganic salts; other inorganic bases; other metal oxides, hydroxides and peroxides:
2825.107- Hydrazine and hydroxylamine and their inorganic saltskgfreefreefreefree
2825.204- Lithium oxide and hydroxidekgfreefreefreefree
2825.309- Vanadium oxides and hydroxideskgfreefreefreefree
2825.403- Nickel oxides and hydroxideskgfreefreefreefree
2825.508- Copper oxides and hydroxideskgfreefreefreefree
2825.602- Germanium oxides and zirconium dioxidekgfreefreefreefree
2825.707- Molybdenum oxides and hydroxideskgfreefreefreefree
2825.801- Antimony oxideskgfreefreefreefree
2825.906- Otherkgfreefreefreefree
Chapter 5
Salts and Peroxysalts, of Inorganic Acids and Metals
HeadingCDDescriptionUnitGeneralEUEFTASADC
28.26Fluorides; fluorosilicates, fluoroaluminates and other complex fluorine salts:
2826.1- Fluorides:
2826.126-- Of aluminiumkgfreefreefreefree
2826.190-- Otherkgfreefreefreefree
2826.302- Sodium hexafluoroaluminate (synthetic cryolite)kgfreefreefreefree
2826.902- Otherkgfreefreefreefree
28.27Chlorides, chloride oxides and chloride hydroxides; bromides and bromide oxides; iodides and iodide oxides:
2827.107- Ammonium chloridekgfreefreefreefree
2827.201- Calcium chloridekgfreefreefreefree
2827.3- Other chlorides:
2827.312-- Of magnesiumkgfreefreefreefree
2827.329-- Of aluminiumkgfreefreefreefree
2827.358-- Of nickelkgfreefreefreefree
2827.39-- Other:
2827.39.100--- Of ironkgfreefreefreefree
2827.39.909--- Otherkgfreefreefreefree
2827.4- Chloride oxides and chloride hydroxides:
2827.417-- Of copperkgfreefreefreefree
2827.498-- Otherkgfreefreefreefree
2827.5- Bromides and bromide oxides:
2827.511-- Bromides of sodium or of potassiumkgfreefreefreefree
2827.592-- Otherkgfreefreefreefree
2827.603- Iodides and iodide oxideskgfreefreefreefree
28.28Hypochlorites; commercial calcium hypochlorite; chlorites; hypobromites:
2828.100- Commercial calcium hypochlorite and other calcium hypochloriteskg10%freefreefree
2828.907- Otherkgfreefreefreefree
28.29Chlorates and perchlorates; bromates and perbromates; iodates and periodates:
2829.1- Chlorates:
2829.110-- Of sodiumkgfreefreefreefree
2829.191-- Otherkgfreefreefreefree
2829.900- Otherkgfreefreefreefree
28.30Sulphides; polysulphides, whether or not chemically defined:
2830.104- Sodium sulphideskgfreefreefreefree
2830.900- Otherkgfreefreefreefree
28.31Dithionites and sulphoxylates:
2831.108- Of sodiumkgfreefreefreefree
2831.904- Otherkgfreefreefreefree
28.32Sulphites; thiosulphates:
2832.101- Sodium sulphiteskgfreefreefreefree
2832.206- Other sulphiteskgfreefreefreefree
2832.300- Thiosulphateskgfreefreefreefree
28.33Sulphates; alums; peroxosulphates (persulphates):
2833.1- Sodium sulphates:
2833.111-- Disodium sulphatekgfreefreefreefree
2833.192-- Otherkgfreefreefreefree
2833.2- Other sulphates:
2833.216-- Of magnesiumkgfreefreefreefree
2833.222-- Of aluminiumkgfreefreefreefree
2833.245-- Of nickelkgfreefreefreefree
2833.251-- Of copperkgfreefreefreefree
2833.274-- Of bariumkgfreefreefreefree
2833.29-- Other:
2833.29.104--- Of zinckgfreefreefreefree
2833.29.902--- Otherkgfreefreefreefree
2833.304- Alumskgfreefreefreefree
2833.409- Peroxosulphates (persulphates)kgfreefreefreefree
28.34Nitrites; nitrates:
2834.109- Nitriteskgfreefreefreefree
2834.2- Nitrates:
2834.216-- Of potassiumkgfreefreefreefree
2834.290-- Otherkgfreefreefreefree
28.35Phosphinates (hypophosphites), phosphonates (phosphites) and phosphates; polyphosphates, whether or not chemically defined:
2835.102- Phosphinates (hypophosphites) and phosphonates (phosphites)kgfreefreefreefree
2835.2- Phosphates:
2835.225-- Of mono- or disodiumkgfreefreefreefree
2835.242-- Of potassiumkgfreefreefreefree
2835.259-- Calcium hydrogenorthophosphate ("dicalcium phosphate")kg10%freefreefree
2835.26-- Other phosphates of calcium:
2835.26.102--- Monocalcium phosphatekg10%freefreefree
2835.26.900--- Otherkgfreefreefreefree
2835.294-- Otherkgfreefreefreefree
2835.3- Polyphosphates:
2835.318-- Sodium triphosphate (sodium tripolyphosphate)kgfreefreefreefree
2835.399-- Otherkgfreefreefreefree
28.36Carbonates; peroxocarbonates (percarbonates); commercial ammonium carbonate containing ammonium carbamate:
2836.200- Disodium carbonatekg5,5%5,5%freefree
2836.305- Sodium hydrogencarbonate (sodium bicarbonate)kgfreefreefreefree
2836.404- Potassium carbonateskgfreefreefreefree
2836.504- Calcium carbonatekgfreefreefreefree
2836.609- Barium carbonatekgfreefreefreefree
2836.9- Other:
2836.919-- Lithium carbonateskgfreefreefreefree
2836.925-- Strontium carbonatekgfreefreefreefree
2836.998-- Otherkgfreefreefreefree
28.37Cyanides, cyanide oxides and complex cyanides:
2837.1- Cyanides and cyanide oxides:
2837.116-- Of sodiumkgfreefreefreefree
2837.197-- Otherkgfreefreefreefree
2837.204- Complex cyanideskgfreefreefreefree
28.39Silicates; commercial alkali metal silicates:
2839.1- Of sodium:
2839.113-- Sodium metasilicateskgfreefreefreefree
2839.194-- Otherkgfreefreefreefree
2839.903- Otherkgfreefreefreefree
28.40Borates; peroxoborates (perborates):
2840.1- Disodium tetraborate (refined borax):
2840.113-- Anhydrouskgfreefreefreefree
2840.194-- Otherkgfreefreefreefree
2840.201- Other borateskgfreefreefreefree
2840.306- Peroxoborates (perborates)kgfreefreefreefree
28.41Salts of oxometallic or peroxometallic acids:
2841.307- Sodium dichromatekgfreefreefreefree
2841.509- Other chromates and dichromates; peroxochromateskgfreefreefreefree
2841.6- Manganites, manganates and permanganates:
2841.615-- Potassium permanganatekgfreefreefreefree
2841.690-- Otherkgfreefreefreefree
2841.708- Molybdateskgfreefreefreefree
2841.802- Tungstates (wolframates)kgfreefreefreefree
2841.907- Otherkgfreefreefreefree
28.42Other salts of inorganic acids or peroxoacids (including aluminosilicates whether or not chemically defined) (excluding azides):
2842.104- Double or complex silicates, including aluminosilicates whether or not chemically definedkgfreefreefreefree
2842.900- Otherkgfreefreefreefree
Chapter 6
Miscellaneous
HeadingCDDescriptionUnitGeneralEUEFTASADC
28.43Colloidal precious metals; inorganic or organic compounds of precious metals; whether or not chemically defined; amalgams of precious metals:
2843.108- Colloidal precious metalskgfreefreefreefree
2843.2- Silver compounds:
2843.219-- Silver nitratekgfreefreefreefree
2843.293-- Otherkg10%freefreefree
2843.307- Gold compoundskgfreefreefreefree
2843.904- Other compounds; amalgamskgfreefreefreefree
28.44Radioactive chemical elements and radioactive isotopes (including the fissile or fertile chemical elements and isotopes) and their compounds; mixtures and residues containing these products:
2844.101- Natural uranium and its compounds; alloys, dispersions (including cermets), ceramic products and mixtures containing natural uranium or natural uranium compoundskgfreefreefreefree
2844.206- Uranium enriched in U 235 and its compounds; plutonium and its compounds; alloys, dispersions (including cermets), ceramic products and mixtures containing uranium enriched in U 235, plutonium or compounds of these productskgfreefreefreefree
2844.300- Uranium depleted in U 235 and its compounds; thorium and its compounds; alloys, dispersions (including cermets), ceramic products and mixtures containing uranium depleted in U 235, thorium or compounds of these productskgfreefreefreefree
2844.405- Radioactive elements and isotopes and compounds (excluding those of subheading 2844.10, 2844.20 or 2844.30); alloys, dispersions (including cermets), ceramic products and mixtures containing these elements, isotopes or compounds; radioactive residueskgfreefreefreefree
2844.504- Spent (irradiated) fuel elements (cartridges) of nuclear reactorskgfreefreefreefree
28.45Isotopes (excluding those of heading 28.44); compounds, inorganic or organic, of such isotopes, whether or not chemically defined:
2845.105- Heavy water (deuterium oxide)kgfreefreefreefree
2845.901- Otherkgfreefreefreefree
28.46Compounds, inorganic or organic, of rare-earth metals, of yttrium or of scandium or of mixtures of these metals:
2846.109- Cerium compoundskgfreefreefreefree
2846.905- Otherkgfreefreefreefree
2847.00Hydrogen peroxide, whether or not solidified with urea:
2847.00.156- Not solidified with ureakg10%freefreefree
2847.00.304- Solidified with ureakgfreefreefreefree
28.49Carbides, whether or not chemically defined:
2849.103- Of calciumkgfreefreefreefree
2849.204- Of siliconkgfreefreefreefree
2849.906- Otherkgfreefreefreefree
2850.005Hydrides, nitrides, azides, silicides and borides, whether or not chemically defined (excluding compounds which are also carbides of heading 28.49)kgfreefreefreefree
28.52Inorganic or organic compounds of mercury, whether or not chemically defined (excluding amalgams):
2852.107- Chemically definedkgfreefreefreefree
2852.903- Otherkgfreefreefreefree
28.53Phosphides, whether or not chemically defined, (excluding ferrosphorous; other inorganic compounds) (including distilled or conductivity water and water of similar purity); liquid air (whether or not rare gases have been removed); compressed air; amalgams (excluding amalgams of precious metals):
2853.100- Cyanogen chloride (chlorcyan)kgfreefreefreefree
2853.90- Other:
2853.90.104-- Phosphides, whether or not chemically defined (excluding ferrophosphorous)kgfreefreefreefree
2853.90.902-- Otherkgfreefreefreefree
Chapter 29
Organic Chemicals

Notes

1.

Except where the context otherwise requires, the headings of this Chapter apply only to the following:

(a)

separate chemically defined organic compounds, whether or not containing impurities;

(b)

mixtures of two or more isomers of the same organic compound (whether or not containing impurities), except mixtures of acyclic hydrocarbon isomers (excluding stereoisomers), whether or not saturated (Chapter 27);

(c)

the products of headings 29.36 to 29.39 or the sugar ethers, sugar acetals and sugar esters, and their salts, of heading 29.40, or the products of heading 29.41, whether or not chemically defined;

(d)

the products mentioned in (a), (b) or (c) above dissolved in water;

(e)

the products mentioned in (a), (b) or (c) above dissolved in other solvents provided the solution constitutes a normal and necessary method of putting up these products adopted solely for reasons of safety or for transport and that the solvent does not render the product particularly suitable for specific use rather than for general use;

(f)

the products mentioned in (a), (b), (c), (d) or (e) above with an added stabiliser (including an anti-caking agent) necessary for their preservation or transport;

(g)

the products mentioned in (a), (b), (c), (d), (e) or (f) above with an added anti-dusting agent or a colouring or odoriferous substance added to facilitate their identification or for safety reasons, provided the additions do not render the product particularly suitable for specific use rather than for general use;

(h)

the following products, diluted to standard strengths, for the production of azo dyes: diazonium salts, couplers used for these salts and diazotisable amines and their salts.

2.

This Chapter does not cover the following:

(a)

goods of heading 15.04 or crude glycerol of heading 15.20;

(b)

ethyl alcohol (heading 22.07 or 22.08);

(c)

methane or propane (heading 27.11);

(d)

the compounds of carbon mentioned in Note 2 to Chapter 28;

(e)

immunological products of heading 30.02;

(f)

urea (heading 31.02 or 31.05);

(g)

colouring matter of vegetable or animal origin (heading 32.03), synthetic organic colouring matter, synthetic organic products of a kind used as fluorescent brightening agents or as luminophores (heading 32.04) or dyes or other colouring matter put up in forms or packings for retail sale (heading 32.12);

(h)

enzymes (heading 35.07);

(ij)

metaldehyde, hexamethylenetetramine or similar substances, put up in forms (for example, tablets, sticks or similar forms) for use as fuels, or liquid or liquefied-gas fuels in containers of a kind used for filling or refilling cigarette or similar lighters and of a capacity not exceeding 300 cm³ (heading 36.06);

(k)

products put up as charges for fire-extinguishers or put up in fire-extinguishing grenades, of heading 38.13; ink removers put up in packings for retail sale, of heading 38.24; or

(l)

optical elements, for example, of ethylenediamine tartrate (heading 90.01).

3.

Goods which could be included in two or more of the headings of this Chapter are to be classified in that one of those headings which occurs last in numerical order.

4.

In headings 29.04 to 29.06, 29.08 to 29.11 and 29.13 to 29.20, any reference to halogenated, sulphonated, nitrated or nitrosated derivatives includes a reference to compound derivatives, such as sulphohalogenated, nitrohalogenated, nitrosulphonated or nitrosulphohalogenated derivatives. Nitro or nitroso groups are not to be taken as "nitrogen-functions" for the purposes of heading 29.29.

For the purposes of headings 29.11, 29.12, 29.14, 29.18 and 29.22, "oxygen-function" is to be restricted to the functions (the characteristic organic oxygen-containing groups) referred to in headings 29.05 to 29.20.

5.

(A)

The esters of acid-function organic compounds of sub-chapters I to VII with organic compounds of these sub-chapters are to be classified with that compound which is classified in the heading which occurs last in numerical order in these sub-chapters.

(B)

Esters of ethyl alcohol with acid-function organic compounds of sub-chapters I to VII are to be classified in the same heading as the corresponding acid-function compounds.

(C)

Subject to Note 1 to Section VI and Note 2 to Chapter 28:

(i)

inorganic salts of organic compounds such as acid-, phenol- or enol-function compounds or organic bases, of sub-chapters I to X or heading 29.42, are to be classified in the heading appropriate to the organic compound;

(ii)

salts formed between organic compounds of sub-chapters I to X or heading 29.42 are to be classified in the heading appropriate to the base or to the acid (including phenol- or enol-function compounds) from which they are formed, whichever occurs last in numerical order in the Chapter; and

(iii

co-ordination compounds, other than products classifiable in sub-Chapter XI or heading 29.41, are to be classified in the heading which occurs last in numerical order in Chapter 29, among those appropriate to the fragments formed by "cleaving" of all metal bonds, other than metal-carbon bonds.

(D)

Metal alcoholates are to be classified in the same heading as the corresponding alcohols except in the case of ethanol (heading 29.05).

(E)

Halides of carboxylic acids are to be classified in the same heading as the corresponding acids.

6.

The compounds of headings 29.30 and 29.31 are organic compounds the molecules of which contain, in addition to atoms of hydrogen, oxygen or nitrogen, atoms of other non-metals or of metals (such as sulphur, arsenic or lead) directly linked to carbon atoms. Heading 29.30 (organo-sulphur compounds) and heading 29.31 (other organo-inorganic compounds) do not include sulphonated or halogenated derivatives (including compound derivatives) which, apart from hydrogen, oxygen and nitrogen, only have directly linked to carbon the atoms of sulphur or of a halogen which give them their nature of sulphonated or halogenated derivatives (or compound derivatives).

7.

Headings 29.32, 29.33 and 29.34 do not include epoxides with a three-membered ring, ketone peroxides, cyclic polymers of aldehydes or of thioaldehydes, anhydrides of polybasic carboxylic acids, cyclic esters of polyhydric alcohols or phenols with polybasic acids, or imides of polybasic acids. These provisions apply only when the ring-position hetero-atoms are those resulting solely from the cyclising function or functions here listed.

8.

For the purposes of heading 29.37:

(a)

the term "hormones" includes hormone-releasing or hormone-stimulating factors, hormone inhibitors and hormone antagonists (anti-hormones);

(b)

the expression "used primarily as hormones" applies not only to hormone derivatives and structural analogues used primarily for their hormonal effect, but also to those derivatives and structural analogues used primarily as intermediates in the synthesis of products of this heading.

Subheading Notes

1.

Within any one heading of this Chapter, derivatives of a chemical compound (or group of chemical compounds) are to be classified in the same subheading as that compound (or group of compounds) provided that they are not more specifically covered by any other subheading and that there is no residual subheading named "Other" in the series of subheadings concerned.

2.

Note 3 to Chapter 29 does not apply to the subheadings of this Chapter.

Chapter 1
Hydrocarbons and their Halogenated, Sulphonated, Nitrated or Nitrosated Derivatives
HeadingCDDescriptionUnitGeneralEUEFTASADC
29.01Acyclic hydrocarbons:
2901.101- Saturatedkgfreefreefreefree
2901.2- Unsaturated:
2901.212-- Ethylenekgfreefreefreefree
2901.229-- Propene (propylene)kgfreefreefreefree
2901.235-- Butene (butylene) and isomers thereofkgfreefreefreefree
2901.241-- Buta-1,3-diene and isoprenekgfreefreefreefree
2901.293-- Otherkgfreefreefreefree
29.02Cyclic hydrocarbons:
2902.1- Cyclanes, cyclenes and cycloterpenes:
2902.111-- Cyclohexanekgfreefreefreefree
2902.192-- Otherkgfreefreefreefree
2902.209- Benzenekgfreefreefreefree
2902.304- Toluenekgfreefreefreefree
2902.4- Xylenes:
2902.415-- o-Xylenekgfreefreefreefree
2902.421-- m-Xylenekgfreefreefreefree
2902.438-- p-Xylenekgfreefreefreefree
2902.444-- Mixed xylene isomerskgfreefreefreefree
2902.503- Styrenekgfreefreefreefree
2902.608- Ethylbenzenekgfreefreefreefree
2902.702- Cumenekgfreefreefreefree
2902.901- Otherkgfreefreefreefree
29.03Halogenated derivatives of hydrocarbons:
2903.1- Saturated chlorinated derivatives of acyclic hydrocarbons:
2903.115-- Chloromethane (methyl chloride) and chloroethane (ethyl chloride)kgfreefreefreefree
2903.121-- Dichloromethane (methylene chloride)kgfreefreefreefree
2903.138-- Chloroform (trichloromethane)kgfreefreefreefree
2903.144-- Carbon tetrachloridekgfreefreefreefree
2903.150-- Ethylene dichloride (ISO) (1,2-dichloroethane)kgfreefreefreefree
2903.19-- Other:
2903.19.103--- 1,1,1-Trichloroethane (methyl chloroform)kgfreefreefreefree
2903.19.138--- Short-chained chlorinated paraffinkgfreefreefreefree
2903.19.901--- Otherkgfreefreefreefree
2903.2- Unsaturated chlorinated derivatives of acyclic hydrocarbons:
2903.218-- Vinyl chloride (chloroethylene)kgfreefreefreefree
2903.226-- Trichloroethylenekgfreefreefreefree
2903.232-- Tetrachloroethylene (perchloroethylene)kgfreefreefreefree
2903.29-- Other:
2903.29.108--- Hexachlorobutadienekgfreefreefreefree
2903.29.906--- Otherkgfreefreefreefree
2903.3- Fluorinated, brominated or iodinated derivatives of acyclic hydrocarbons:
2903.314-- Ethylene dibromide (ISO) (1,2-dibromoethane)kgfreefreefreefree
2903.39-- Other:
2903.39.102--- Perfluorooctane sulfonyl fluoride (PFOSF)kgfreefreefreefree
2903.39.204--- Bromomethane (methyl bromide)kgfreefreefreefree
2903.39.307--- Pentafluoroethane (R-125)kgfreefreefreefree
2903.39.404--- 1,1-Difluoroethane (R-152a)kgfreefreefreefree
2903.39.501--- 1.1.1-trifluoroethane (R-143a)kgfreefreefreefree
2903.39.552--- 1,1,1,3,3-Pentafluoropropane (R-245fa)kgfreefreefreefree
2903.39.609--- 2,3,3,3-Tetrafluoropropene (R-1234yf)kgfreefreefreefree
2903.39.652--- 1,1,1,2-Tetrafluoroethane (R134a)kgfreefreefreefree
2903.39.676--- Trifluoromethane (R-23)kgfreefreefreefree
2903.39.706--- Difluoromethane (R-32)kgfreefreefreefree
2903.39.900--- Otherkgfreefreefreefree
2903.7- Halogenated derivatives of acyclic hydrocarbons containing two or more different halogens:
2903.712-- Chlorodifluoromethane (R-22)kgfreefreefreefree
2903.729-- Dichlorotrifluoroethanes (R-123)kgfreefreefreefree
2903.735-- Dichlorofluoroethanes (R-141b)kgfreefreefreefree
2903.741-- Chlorodifluoroethanes (R-142)kgfreefreefreefree
2903.758-- Dichloropentafluoropropaneskgfreefreefreefree
2903.764-- Bromochlorodif luoromethane, bromotrif luoromethane and dibromotetraf luoroethaneskgfreefreefreefree
2903.77-- Other, perhalogenated only with fluorine and chlorine:
2903.77.051--- Trichlorofluoromethanekgfreefreefreefree
2903.77.108--- Dichlorodifluoromethanekgfreefreefreefree
2903.77.159--- Trichlorotrifluoroethaneskgfreefreefreefree
2903.77.205--- Dichlorotetrafluoroethanes and chloropentafluoroethanekgfreefreefreefree
2903.77.256--- Chlorotrifluoromethanekgfreefreefreefree
2903.77.302--- Pentachlorofluoroethanekgfreefreefreefree
2903.77.353--- Tetrachlorodifluoroethaneskgfreefreefreefree
2903.77.402--- Heptachlorofluoropropaneskgfreefreefreefree
2903.77.450--- Hexachlorodifluoropropaneskgfreefreefreefree
2903.77.507--- Pentachlorotrifluoropropaneskgfreefreefreefree
2903.77.558--- Tetrachlorotetrafluoropropaneskgfreefreefreefree
2903.77.604--- Trichloropentafluoropropaneskgfreefreefreefree
2903.77.655--- Dichlorohexafluoropropaneskgfreefreefreefree
2903.77.701--- Chloroheptafluoropropaneskgfreefreefreefree
2903.77.906--- Otherkgfreefreefreefree
2903.787-- Other perhalogenated derivativeskgfreefreefreefree
2903.79-- Other:
2903.79.100--- Chlorotetrafluoroethanes (R-124)kgfreefreefreefree
2903.79.208--- Dichlorodifluoroethaneskgfreefreefreefree
2903.79.305--- Other derivatives of methane, ethane or propane halogenated only with fluorine and chlorinekgfreefreefreefree
2903.79.402--- Derivatives of methane, ethane or propane, halogenated only with fluorine and brominekgfreefreefreefree
2903.79.909--- Otherkgfreefreefreefree
2903.8- Halogenated derivatives of cyclanic, cyclenic or cycloterpenic hydrocarbons:
2903.81-- 1,2,3,4,5,6-Hexachlorocyclohexane (HCH (ISO)), including lindane (ISO, INN):
2903.81.104--- Lindane (ISO, INN)kgfreefreefreefree
2903.81.201--- Alpha-hexachlorocyclohexane (alpha HCH)kgfreefreefreefree
2903.81.309--- Beta-hexachlorocyclohexane (beta HCH)kgfreefreefreefree
2903.81.902--- Otherkgfreefreefreefree
2903.82-- Aldrin (ISO), chlordane (ISO) and heptachlor (ISO):
2903.82.100--- Aldrin (ISO)kgfreefreefreefree
2903.82.208--- Chlordane (ISO)kgfreefreefreefree
2903.82.305--- Heptachlorkgfreefreefreefree
2903.834-- Mirex (ISO)kgfreefreefreefree
2903.89-- Other:
2903.89.202--- Polychlorinated dibenzo-p-dioxinskgfreefreefreefree
2903.89.301--- Dibenzofuranskgfreefreefreefree
2903.89.407--- Hexabromodiphenyl ether (c-octaBDE)kgfreefreefreefree
2903.89.903--- Otherkgfreefreefreefree
2903.9- Halogenated derivatives of aromatic hydrocarbons:
2903.911-- Chlorobenzene, o-dichlorobenzene and p-dichlorobenzenekgfreefreefreefree
2903.92-- Hexachlorobenzene (ISO) and DDT (ISO) (clofenotane (INN), 1,1,1-trichloro-2,2-bis (p-chlorophenyl)ethane):
2903.92.105--- DDT (ISO) (clofenotane (INN), 1,1,1-tr ichloro-2,2-bis(p- chlorophenyl)ethane))kgfreefreefreefree
2903.92.903--- Otherkgfreefreefreefree
2903.934-- Pentachlorobenzene (ISO)kgfreefreefreefree
2903.940-- Hexabromobiphenylskgfreefreefreefree
2903.99-- Other:
2903.99.053--- Polybrominated biphenyls (PBB) (36355-01-8 (hexa-))kgfreefreefreefree
2903.99.101--- Polybrominated biphenyls (PBB) (36355-01-8 (deca-))kgfreefreefreefree
2903.99.150--- Polybrominated biphenyls (PBB) (36355-01-8) (octa-))kgfreefreefreefree
2903.99.207--- Polychlorinated biphenyls (PCB)kgfreefreefreefree
2903.99.258--- Polychlorinated terphenyls (PCT)kgfreefreefreefree
2903.99.908--- Otherkgfreefreefreefree
29.04Sulphonated, nitrated or nitrosated derivatives of hydrocarbons, whether or not halogenated:
2904.10- Derivatives containing only sulpho groups, their salts and ethyl esters:
2904.10.108-- Sulphonic acidskg14%freefreefree
2904.10.908-- Otherkg10%freefreefree
2904.207- Derivatives containing only nitro or only nitroso groupskgfreefreefreefree
2904.3- Perfluorooctane sulphonic acid, its salts and perfluorooctane sulphonyl fluoride:
2904.318-- Perfluorooctane sulphonic acidkgfreefreefreefree
2904.324-- Ammonium perfluorooctane sulphonatekgfreefreefreefree
2904.330-- Lithium perfluorooctane sulphonatekgfreefreefreefree
2904.347-- Potassium perfluorooctane sulphonatekgfreefreefreefree
2904.353-- Other salts of perfluorooctane sulphonic acidkgfreefreefreefree
2904.365-- Perfluorooctane sulphonyl fluoridekgfreefreefreefree
2904.9- Other:
2904.915-- Trichloronitromethane (chloropicrin)kgfreefreefreefree
2904.996-- Otherkgfreefreefreefree
Chapter 2
Alcohols and their Halogenated, Sulphonated, Nitrated or Nitrosated Derivatives
HeadingCDDescriptionUnitGeneralEUEFTASADC
29.05Acyclic alcohols and their halogenated, sulphonated, nitrated or nitrosated derivatives:
2905.1- Saturated monohydric alcohols:
2905.112-- Methanol (methyl alcohol)kgfreefreefreefree
2905.129-- Propan-1-ol (propyl alcohol) and propan-2-ol (isopropyl alcohol)kgfreefreefreefree
2905.135-- Butan-1-ol (n-butyl alcohol)kgfreefreefreefree
2905.141-- Other butanolskgfreefreefreefree
2905.164-- Octanol (octyl alcohol) and isomers thereofkgfreefreefreefree
2905.170-- Dodecan-1-ol (lauryl alcohol) hexadecan-1-ol (cetyl alcohol) and octadecan-1-ol (stearyl alcohol)kgfreefreefreefree
2905.19-- Other:
2905.19.100--- 3,3-Dimethylbutan-2-ol (pinacolyl alcohol)kgfreefreefreefree
2905.19.208--- Pentanol (amyl alcohol) and isomers thereofkgfreefreefreefree
2905.19.909--- Otherkgfreefreefreefree
2905.2- Unsaturated monohydric alcohols:
2905.223-- Acyclic terpene alcoholskgfreefreefreefree
2905.298-- Otherkgfreefreefreefree
2905.3- Diols:
2905.311-- Ethylene glycol (ethanediol)kgfreefreefreefree
2905.328-- Propylene glycol (propane-1,2-diol)kgfreefreefreefree
2905.392-- Otherkgfreefreefreefree
2905.4- Other polyhydric alcohols:
2905.416-- 2-Ethyl-2-(hydroxymethyl)propane-1,3-diol (trimethylolpropane)kgfreefreefreefree
2905.422-- Pentaerythritolkgfreefreefreefree
2905.439-- Mannitolkgfreefreefreefree
2905.445-- D-glucitol (sorbitol)kgfreefreefreefree
2905.451-- Glycerolkg10%freefreefree
2905.497-- Otherkgfreefreefreefree
2905.5- Halogenated, sulphonated, nitrated or nitrosated derivatives of acyclic alcohols:
2905.510-- Ethchlorvynol (INN)kgfreefreefreefree
2905.591-- Otherkgfreefreefreefree
29.06Cyclic, alcohols and their halogenated, sulphonated, nitrated or nitrosated derivatives:
2906.1- Cyclanic, cyclenic or cycloterpenic:
2906.116-- Mentholkgfreefreefreefree
2906.122-- Cyclohexanol, methylcyclohexanols and dimethylcyclohexanolskgfreefreefreefree
2906.139-- Sterols and inositolskgfreefreefreefree
2906.197-- Otherkgfreefreefreefree
2906.2- Aromatic:
2906.210-- Benzyl alcoholkgfreefreefreefree
2906.29-- Other:
2906.29.109--- 2,2,2-Trichloro-1,1-bis(4-chlorophenyl) ethanol (Dicofol)kgfreefreefreefree
2906.29.907--- Otherkgfreefreefreefree
Chapter 3
Phenols, Phenol-alcohols, and their Halogenated, Sulphonated, Nitrated or Nitrosated Derivatives
HeadingCDDescriptionUnitGeneralEUEFTASADC
29.07Phenols; phenol-alcohols:
2907.1- Monophenols:
2907.116-- Phenol (hydroxybenzene) and its saltskgfreefreefreefree
2907.126-- Cresols and their saltskgfreefreefreefree
2907.132-- Octylphenol, nonylphenol and their isomers; salts thereofkgfreefreefreefree
2907.155-- Naphthols and their saltskgfreefreefreefree
2907.190-- Otherkgfreefreefreefree
2907.2- Polyphenols; phenol-alcohols:
2907.214-- Resorcinol and its saltskgfreefreefreefree
2907.220-- Hydroquinone (quinol) and its saltskgfreefreefreefree
2907.237-- 4,4-Isopropylidenediphenol (bisphenol A, diphenylolpropane) and its saltskgfreefreefreefree
2907.295-- Otherkgfreefreefreefree
29.08Halogenated, sulphonated, nitrated or nitrosated derivatives of phenols or phenol-alcohols:
2908.1- Derivatives containing only halogen substituents and their salts:
2908.113-- Pentachlorophenol (ISO)kgfreefreefreefree
2908.194-- Otherkgfreefreefreefree
2908.9- Other:
2908.911-- Dinoseb (ISO) and its saltskgfreefreefreefree
2908.926-- 4,6-Dinitro-o-cresol (DNOC (ISO)) and its saltskgfreefreefreefree
2908.990-- Otherkgfreefreefreefree
Chapter 4
Ethers, Alcohol Peroxides, Ether Peroxides, Ketone Peroxides, Epoxides with a Three-membered Ring, Acetals and Hemiacetals, and their Halogenated, Sulphonated, Nitraded or Nitrosated Derivatives
HeadingCDDescriptionUnitGeneralEUEFTASADC
29.09Ethers, ether-alcohols, ether-phenols, ether-alcohol-phenols, alcohol peroxides, ether peroxides, ketone peroxides (whether or not chemically defined), and their halogenated, sulphonated, nitrated or nitrosated derivatives:
2909.1- Acyclic ethers and their halogenated, sulphonated, nitrated or nitrosated derivatives:
2909.117-- Diethyl etherkgfreefreefreefree
2909.198-- Otherkgfreefreefreefree
2909.205- Cyclanic, cyclenic or cycloterpenic ethers and their halogenated, sulphonated, nitrated or nitrosated derivativeskgfreefreefreefree
2909.30- Aromatic ethers and their halogenated, sulphonated, nitrated or nitrosated derivatives:
2909.30.050-- Decabromodiphenyl etherkgfreefreefreefree
2909.30.107-- Pentabromodiphenyl ether (c-pentaBDE)kgfreefreefreefree
2909.30.204-- Tetrabromodiphenyl etherkgfreefreefreefree
2909.30.905-- Otherkgfreefreefreefree
2909.4- Ether-alcohols and their halogenated, sulphonated, nitrated or nitrosated derivatives:
2909.410-- 2,2'-Oxydiethanol (diethylene glycol, digol)kgfreefreefreefree
2909.433-- Monobutyl ethers of ethylene glycol or of diethylene glycolkgfreefreefreefree
2909.442-- Other monoalkylethers of ethylene glycol or of diethylene glycolkgfreefreefreefree
2909.491-- Otherkgfreefreefreefree
2909.509- Ether-phenols, ether-alcohol-phenols and their halogenated, sulphonated, nitrated or nitrosated derivativeskgfreefreefreefree
2909.603- Alcohol peroxides, ether peroxides, ketone peroxides and their halogenated, sulphonated, nitrated or nitrosated derivativeskgfreefreefreefree
29.10Epoxides, epoxyalcohols, epoxyphenols and epoxyethers, with a three-membered ring, and their halogenated, sulphonated, nitrated or nitrosated derivatives:
2910.100- Oxirane (ethylene oxide)kgfreefreefreefree
2910.205- Methyloxirane (propylene oxide)kgfreefreefreefree
2910.309- 1-Chloro-2,3-epoxypropane (epichlorohydrin)kgfreefreefreefree
2910.404- Dieldrin (ISO, INN)kgfreefreefreefree
2910.509- Endrin (ISO)kgfreefreefreefree
2910.907- Otherkgfreefreefreefree
2911.000Acetals and hemiacetals, whether or not with other oxygen function, and their halogenated, sulphonated, nitrated or nitrosated derivativeskgfreefreefreefree
Chapter 5
Aldehyde-function Compounds
HeadingCDDescriptionUnitGeneralEUEFTASADC
29.12Aldehydes, whether or not with other oxygen function; cyclic polymers of aldehydes; paraformaldehyde:
2912.1- Acyclic aldehydes without other oxygen function:
2912.114-- Methanal (formaldehyde)kgfreefreefreefree
2912.120-- Ethanal (acetaldehyde)kgfreefreefreefree
2912.195-- Otherkgfreefreefreefree
2912.2- Cyclic aldehydes without other oxygen function:
2912.219-- Benzaldehydekgfreefreefreefree
2912.295-- Otherkgfreefreefreefree
2912.4- Aldehyde-alcohols, aldehyde-ethers, aldehyde-phenols and aldehydes with other oxygen function:
2912.418-- Vanillin (4-hydroxy-3-methoxybenzaldehyde)kgfreefreefreefree
2912.424-- Ethylvanillin (3-ethoxy-4-hydroxybenzaldehyde)kgfreefreefreefree
2912.49-- Other:
2912.49.106--- Aldehyde-alcoholskgfreefreefreefree
2912.49.904--- Otherkgfreefreefreefree
2912.506- Cyclic polymers of aldehydeskgfreefreefreefree
2912.600- Paraformaldehydekgfreefreefreefree
2913.007Halogenated, sulphonated, nitrated or nitrosated derivatives of products of heading 29.12kgfreefreefreefree
Chapter 6
Ketone-function Compounds and Quinone-function Compounds
HeadingCDDescriptionUnitGeneralEUEFTASADC
29.14Ketones and quinones, whether or not with other oxygen function, and their halogenated, sulphonated, nitrated or nitrosated derivatives:
2914.1- Acyclic ketones without other oxygen function:
2914.111-- Acetonekgfreefreefreefree
2914.128-- Butanone (methyl ethyl ketone)kgfreefreefreefree
2914.134-- 4-Methylpentan-2-one (methyl isobutyl ketone)kgfreefreefreefree
2914.192-- Otherkgfreefreefreefree
2914.2- Cyclanic, cyclenic or cycloterpenic ketones without other oxygen function:
2914.222-- Cyclohexanone and methylcyclohexanoneskgfreefreefreefree
2914.239-- Ionones and methyliononeskgfreefreefreefree
2914.29-- Other:
2914.29.104--- Camphorkgfreefreefreefree
2914.29.902--- Otherkgfreefreefreefree
2914.3- Aromatic ketones without other oxygen function:
2914.310-- Phenylacetone (phenylpropan-2-one)kgfreefreefreefree
2914.391-- Otherkgfreefreefreefree
2914.409- Ketone-alcohols and ketone-aldehydeskgfreefreefreefree
2914.503- Ketone-phenols and ketones with other oxygen functionkgfreefreefreefree
2914.6- Quinones:
2914.614-- Anthraquinonekgfreefreefreefree
2914.620-- Coenzyme Q10 (ubidecarenone (INN))kgfreefreefreefree
2914.695-- Otherkgfreefreefreefree
2914.7- Halogenated, sulphonated, nitrated or nitrosated derivatives:
2914.719-- Chlordecone (ISO)kgfreefreefreefree
2914.791-- Otherkgfreefreefreefree
Chapter 7
Carboxylic Acids and their Anhydrides, Halides, Peroxides and Peroxyacids and their Halogenated, Sulphonated, Nitrated or Nitrosated Derivatives
HeadingCDDescriptionUnitGeneralEUEFTASADC
29.15Saturated acyclic monocarboxylic acids and their anhydrides, halides, peroxides and peroxyacids; their halogenated, sulphonated, nitrated or nitrosated derivatives:
2915.1- Formic acid, its salts and esters:
2915.115-- Formic acidkgfreefreefreefree
2915.121-- Salts of formic acidkgfreefreefreefree
2915.138-- Esters of formic acidkgfreefreefreefree
2915.2- Acetic acid and its salts; acetic anhydride:
2915.216-- Acetic acidkgfreefreefreefree
2915.249-- Acetic anhydridekgfreefreefreefree
2915.29-- Other:
2915.29.108--- Sodium acetatekgfreefreefreefree
2915.29.906--- Otherkgfreefreefreefree
2915.3- Esters of acetic acid:
2915.314-- Ethyl acetatekgfreefreefreefree
2915.320-- Vinyl acetatekgfreefreefreefree
2915.337-- n-Butyl acetatekgfreefreefreefree
2915.366-- Dinoseb acetatekgfreefreefreefree
2915.39-- Other:
2915.39.202--- Diethylene glycol monobutyl ether acetate; ethylene glycol monobutyl ether acetatekgfreefreefreefree
2915.39.307--- Ethylene glycol monomethyl ether acetate; ethylene glycol monopropyl ether acetatekgfreefreefreefree
2915.39.358--- Isobutyl acetatekgfreefreefreefree
2915.39.404--- Amyl acetatekgfreefreefreefree
2915.39.455--- 2-Ethoxyethyl acetatekgfreefreefreefree
2915.39.609--- Other liquid aromatic esters of acetic acidkgfreefreefreefree
2915.39.900--- Otherkg10%freefreefree
2915.402- Mono-, di- or trichloroacetic acids, their salts and esterskgfreefreefreefree
2915.50- Propionic acid, its salts and esters:
2915.50.309-- Calcium propionatekg15%freefreefree
2915.50.902-- Otherkgfreefreefreefree
2915.601- Butanoic acids, pentanoic acids, their salts and esterskgfreefreefreefree
2915.706- Palmitic acid, stearic acid, their salts and esterskgfreefreefreefree
2915.90- Other:
2915.90.102-- Perfluorooctane sulfonic acid (PFOs)kgfreefreefreefree
2915.90.900-- Otherkgfreefreefreefree
29.16Unsaturated acyclic monocarboxylic acids, cyclic monocarboxylic acids, their anhydrides, halides, peroxides and peroxyacids; their halogenated, sulphonated, nitrated or nitrosated derivatives:
2916.1- Unsaturated acyclic monocarboxylic acids, their anhydrides, halides, peroxides, peroxyacids and their derivatives:
2916.11-- Acrylic acid and its salts:
2916.11.106--- Acrylic acidkgfreefreefreefree
2916.11.203--- Saltskgfreefreefreefree
2916.12-- Esters of acrylic acid:
2916.12.102--- Methyl acrylatekgfreefreefreefree
2916.12.205--- Ethyl acrylatekgfreefreefreefree
2916.12.307--- Butyl acrylatekgfreefreefreefree
2916.12.404--- 2-Ethylhexyl acrylatekgfreefreefreefree
2916.12.900--- Otherkgfreefreefreefree
2916.131-- Methacrylic acid and its saltskgfreefreefreefree
2916.148-- Esters of methacrylic acidkgfreefreefreefree
2916.154-- Oleic, linoleic or linolenic acids, their salts and esterskgfreefreefreefree
2916.160-- Binapacryl (ISO)kgfreefreefreefree
2916.193-- Otherkgfreefreefreefree
2916.207- Cyclanic, cyclenic or cycloterpenic monocarboxylic acids, their anhydrides, halides, peroxides, peroxyacids and their derivativeskgfreefreefreefree
2916.3- Aromatic monocarboxylic acids, their anhydrides, halides, peroxides, peroxyacids and their derivatives:
2916.318-- Benzoic acid, its salts and esterskgfreefreefreefree
2916.324-- Benzoyl peroxide and benzoyl chloridekgfreefreefreefree
2916.347-- Phenylacetic acid and its saltskgfreefreefreefree
2916.39-- Other:
2916.39.106--- Esters of phenylacetic acidkgfreefreefreefree
2916.39.904--- Otherkgfreefreefreefree
29.17Polycarboxylic acids, their anhydrides, halides, peroxides and peroxyacids; their halogenated, sulphonated, nitrated or nitrosated derivatives:
2917.1- Acyclic polycarboxylic acids, their anhydrides, halides, peroxides, peroxyacids and their derivatives:
2917.112-- Oxalic acid, its salts and esterskgfreefreefreefree
2917.12-- Adipic acid, its salts and esters:
2917.12.203--- Dioctyl adipatekg15%freefreefree
2917.12.904--- Otherkgfreefreefreefree
2917.135-- Azelaic acid, sebacic acid, their salts and esterskgfreefreefreefree
2917.141-- Maleic anhydridekg15%freefreefree
2917.19-- Other:
2917.19.356--- Fumaric acidkg10%freefreefree
2917.19.453--- Other acidskgfreefreefreefree
2917.19.909--- Otherkg10%freefreefree
2917.200- Cyclanic, cyclenic or cycloterpenic polycarboxylic acids, their anhydrides, halides, peroxides, peroxyacids and their derivativeskgfreefreefreefree
2917.3- Aromatic polycarboxylic acids, their anhydrides, halides, peroxides, peroxyacids and their derivatives:
2917.328-- Dioctyl orthophthalateskg10%freefreefree
2917.334-- Dinonyl or didecyl orthophthalateskg10%freefreefree
2917.340-- Other esters of orthophthalic acidkg15%freefreefree
2917.357-- Phthalic anhydridekg15%freefreefree
2917.363-- Terephthalic acid and its saltskgfreefreefreefree
2917.372-- Dimethyl terephthalatekgfreefreefreefree
2917.39-- Other:
2917.39.101--- Dibutyl orthophthalateskgfreefreefreefree
2917.39.908--- Otherkgfreefreefreefree
29.18Carboxylic acids with additional oxygen function and their anhydrides, halides, peroxides and peroxyacids; their halogenated, sulphonated, nitrated or nitrosated derivatives:
2918.1- Carboxylic acids with alcohol function but without other oxygen function, their anhydrides, halides, peroxides, peroxyacids and their derivatives:
2918.116-- Lactic acid, its salts and esterskgfreefreefreefree
2918.122-- Tartaric acidkg15%freefreefree
2918.139-- Salts and esters of tartaric acidkgfreefreefreefree
2918.145-- Citric acidkg10%freefreefree
2918.151-- Salts and esters of citric acidkgfreefreefreefree
2918.168-- Gluconic acid, its salts and esterskgfreefreefreefree
2918.174-- 2,2-Diphenyl-2-hydroxyacetic acid (benzilic acid)kgfreefreefreefree
2918.180-- Chlorobenzilate (ISO)kgfreefreefreefree
2918.19-- Other:
2918.19.104--- Malic acidkg10%freefreefree
2918.19.902--- Otherkgfreefreefreefree
2918.2- Carboxylic acids with phenol function but without other oxygen function, their anhydrides, halides, peroxides, peroxyacids and their derivatives:
2918.210-- Salicylic acid and its saltskgfreefreefreefree
2918.227-- O-Acetylsalicylic acid, its salts and esterskgfreefreefreefree
2918.233-- Other esters of salicylic acid and their saltskgfreefreefreefree
2918.291-- Otherkgfreefreefreefree
2918.309- Carboxylic acids with aldehyde or ketone function but without other oxygen function, their anhydrides, halides, peroxides, peroxyacids and their derivativeskgfreefreefreefree
2918.9- Other:
2918.912-- 2,4,5-T (ISO) (2,4,5-trichlorophenoxyacetic acid), its salts and esterskgfreefreefreefree
2918.993-- Otherkgfreefreefreefree
Chapter 8
Esters of Inorganic Acids of Non-metals and their Salts, and their Halogenated, Sulphonated, Nitrated or Nitrosated Derivatives
HeadingCDDescriptionUnitGeneralEUEFTASADC
29.19Phosphoric esters and their salts, including lactophosphates; their halogenated, sulphonated, nitrated or nitrosated derivatives:
2919.103- Tris(2,3-dibromopropyl) phosphatekgfreefreefreefree
2919.900- Otherkgfreefreefreefree
29.20Esters of other inorganic acids of non-metals (excluding esters of hydrogen halides) and their salts; their halogenated, sulphonated, nitrated or nitrosated derivatives:
2920.1- Thiophosphoric esters (phosphorothioates) and their salts; their halogenated, sulphonated, nitrated or nitrosated derivatives:
2920.11-- Parathion (ISO) and parathion-methyl (ISO) (methyl-parathion):
2920.11.018--- Emulsifiable concentrates containing by mass 19,5% of methyl- parathionkgfreefreefreefree
2920.11.026--- Emulsifiable concentrates containing by mass 40% of methyl- parathionkgfreefreefreefree
2920.11.034--- Emulsifiable concentrates containing by mass 50% of methyl- parathionkgfreefreefreefree
2920.11.042--- Emulsifiable concentrate containing by mass 60% of methyl- parathionkgfreefreefreefree
2920.11.050--- Dust containing by mass 1,5% of methyl-parathionkgfreefreefreefree
2920.11.069--- Dust containing by mass 2% of methyl-parathionkgfreefreefreefree
2920.11.077--- Dust containing by mass 3% of methyl-parathionkgfreefreefreefree
2920.11.093--- Parathion (ISO)kgfreefreefreefree
2920.11.905--- Otherkgfreefreefreefree
2920.190-- Otherkgfreefreefreefree
2920.2- Phosphite esters and their salts; their halogenated, sulphonated, nitrated or nitrosated derivatives:
2920.214-- Dimethyl phosphitekgfreefreefreefree
2920.220-- Diethyl phosphitekgfreefreefreefree
2920.237-- Trimethyl phosphitekgfreefreefreefree
2920.243-- Triethyl phosphitekgfreefreefreefree
2920.295-- Otherkgfreefreefreefree
2920.302- Endosulfan (ISO)kgfreefreefreefree
2920.905- Otherkgfreefreefreefree
Chapter 9
Nitrogen-function Compounds
HeadingCDDescriptionUnitGeneralEUEFTASADC
29.21Amine-function compounds:
2921.1- Acyclic monoamines and their derivatives; salts thereof:
2921.113-- Methylamine, di- or trimethylamine and their saltskgfreefreefreefree
2921.128-- 2-(N,N-Dimethylamino)ethylchloride hydrochloridekgfreefreefreefree
2921.136-- 2-(N,N-Diethylamino)ethylchloride hydrochloridekgfreefreefreefree
2921.142-- 2-(N,N-Diisopropylamino)ethylchloride hydrochloridekgfreefreefreefree
2921.19-- Other:
2921.19.152--- Ethylamine; monoisopropylaminekgfreefreefreefree
2921.19.209--- Bis (2-chloroethyl) ethylaminekgfreefreefreefree
2921.19.254--- Chlormethine (INN) (bis (2-chloroethyl) methylamine)kgfreefreefreefree
2921.19.306--- Trichlormethine (INN) (tris (2-chloroethyl) amine)kgfreefreefreefree
2921.19.357--- N ,N-Dia lky l (methy l , e thy l , n -propy l o r isopropy l) 2- ch loroethy lamines and the ir pro tonated sa lts 8 22kgfreefreefreefree
2921.19.802--- Other, of a carbon chain length of C to Ckg10%freefreefree
2921.19.903--- Otherkgfreefreefreefree
2921.2- Acyclic polyamines and their derivatives; salts thereof:
2921.218-- Ethylenediamine and its saltskgfreefreefreefree
2921.224-- Hexamethylenediamine and its saltskgfreefreefreefree
2921.299-- Otherkgfreefreefreefree
2921.306- Cyclanic, cyclenic and cycloterpenic mono- or polyamines, and their derivatives; salts thereofkgfreefreefreefree
2921.4- Aromatic monoamines and their derivatives; salts thereof:
2921.417-- Aniline and its saltskgfreefreefreefree
2921.423-- Aniline derivatives and their saltskgfreefreefreefree
2921.436-- Toluidines and their derivatives; salts thereofkgfreefreefreefree
2921.44-- Diphenylamine and its derivatives; salts thereof:
2921.44.200--- Diphenylamine; octylated diphenylaminekgfreefreefreefree
2921.44.901--- Otherkg10%freefreefree
2921.452-- 1-Naphthylamine (alpha-naphthylamine), 2-naphthylamine (beta- naphthylamine) and their derivatives; salts thereofkgfreefreefreefree
2921.469-- Amfetamine (INN), benzfetamine (INN), dexamfetamine (INN), etilamfetamine (INN), fencamfamin (INN), lefetamine (INN), levamfetamine (INN), mefenorex (INN) and phentermine (INN); salts thereofkgfreefreefreefree
2921.498-- Otherkgfreefreefreefree
2921.5- Aromatic polyamines and their derivatives; salts thereof:
2921.51-- o-, m-, p-Phenylenediamine, diaminotoluenes, and their derivatives; salts thereof:
2921.51.206--- Derivatives of o- or m-phenylenediaminekgfreefreefreefree
2921.51.907--- Otherkgfreefreefreefree
2921.592-- Otherkgfreefreefreefree
29.22Oxygen-function amino-compounds:
2922.1- Amino-alcohols (excluding those containing more than one kind of oxygen function), their ethers and esters; salts thereof:
2922.117-- Monoethanolamine and its saltskgfreefreefreefree
2922.123-- Diethanolamine and its saltskgfreefreefreefree
2922.146-- Dextropropoxyphene (INN) and its saltskgfreefreefreefree
2922.152-- Triethanolaminekgfreefreefreefree
2922.169-- Diethanolammonium perfluorooctane sulphonatekgfreefreefreefree
2922.175-- Methyldiethanolamine and ethyldiethanolaminekgfreefreefreefree
2922.181-- 2-(N,N-Diisopropylamino)ethanolkgfreefreefreefree
2922.19-- Other:
2922.19.105--- Triethanolamine saltskgfreefreefreefree
2922.19.407--- N,N-Dimethyl-2-aminoethanol and its protonated saltskgfreefreefreefree
2922.19.504--- N,N-Diethyl-2-aminoethanol and its protonated saltskgfreefreefreefree
2922.19.601--- N-N-Dialkyl (methyl, ethyl, n-propyl or isopropyl)-2-aminoethanols and their protonated salts not elsewhere specified or includedkgfreefreefreefree
2922.19.903--- Otherkgfreefreefreefree
2922.2- Amino-naphthols and other amino-phenols (excluding those containing more than one kind of oxygen function), their ethers and esters; salts thereof:
2922.211-- Aminohydroxynaphthalenesulphonic acids and their saltskgfreefreefreefree
2922.292-- Otherkgfreefreefreefree
2922.3- Amino-aldehydes, amino-ketones and amino-quinones (excluding those containing more than one kind of oxygen function); salts thereof:
2922.316-- Amfepramone (INN), methadone (INN) and normethadone (INN); salts thereofkgfreefreefreefree
2922.397-- Otherkgfreefreefreefree
2922.4- Amino-acids (excluding those containing more than one kind of oxygen function), and their esters; salts thereof:
2922.410-- Lysine and its esters; salts thereofkgfreefreefreefree
2922.427-- Glutamic acid and its saltskgfreefreefreefree
2922.433-- Anthranilic acid and its saltskgfreefreefreefree
2922.445-- Tilidine (INN) and its saltskgfreefreefreefree
2922.491-- Otherkgfreefreefreefree
2922.509- Amino-alcohol-phenols, amino-acid-phenols and other amino compounds with oxygen functionkgfreefreefreefree
29.23Quaternary ammonium salts and hydroxides; lecithins and other phosphoaminolipids, whether or not chemically defined:
2923.104- Choline and its saltskgfreefreefreefree
2923.209- Lecithins and other phosphoaminolipidskgfreefreefreefree
2923.303- Tetraethylammonium perfluorooctane sulphonatekgfreefreefreefree
2923.408- Didecyldimethylammonium perfluorooctane sulphonatekgfreefreefreefree
2923.90- Other:
2923.90.108-- Diallyl dimethyl ammonium chloridekgfreefreefreefree
2923.90.906-- Otherkgfreefreefreefree
29.24Carboxyamide-function compounds; amide-function compounds of carbonic acid:
2924.1- Acyclic amides (including acyclic carbamates) and their derivatives; salts thereof:
2924.114-- Meprobamate (INN)kgfreefreefreefree
2924.12-- Fluoroacetamide (ISO), monocrotophos (ISO) and phosphamidon (ISO):
2924.12.108--- Soluble liquids containing more than 1 000g/li of phosphamidon (ISO)kgfreefreefreefree
2924.12.205--- Fluoroacetamidekgfreefreefreefree
2924.12.302--- Monocrotophos (ISO)kgfreefreefreefree
2924.12.906--- Otherkgfreefreefreefree
2924.195-- Otherkgfreefreefreefree
2924.2- Cyclic amides (including cyclic carbamates) and their derivatives; salts thereof:
2924.21-- Ureines and their derivatives; salts thereof:
2924.21.106--- Diuronkgfreefreefreefree
2924.21.904--- Otherkgfreefreefreefree
2924.231-- 2-Acetamidobenzoic acid (N-acetylanthranilic acid) and its saltskgfreefreefreefree
2924.248-- Ethinamate (INN)kgfreefreefreefree
2924.254-- Alachlor (ISO)kgfreefreefreefree
2924.29-- Other:
2924.29.050--- Acetaminophenolkg10%10%10%free
2924.29.905--- Otherkgfreefreefreefree
29.25Carboxyimide-function compounds (including saccharin and its salts) and imine-function compounds:
2925.1- Imides and their derivatives; salts thereof:
2925.118-- Saccharin and its saltskgfreefreefreefree
2925.124-- Glutethimide (INN)kgfreefreefreefree
2925.199-- Otherkgfreefreefreefree
2925.2- Imines and their derivatives; salts thereof:
2925.212-- Chlordimeform (ISO)kgfreefreefreefree
2925.293-- Otherkgfreefreefreefree
29.26Nitrile-function compounds:
2926.105- Acrylonitrilekgfreefreefreefree
2926.205- 1-Cyanoguanidine (dicyandiamide)kgfreefreefreefree
2926.304- Fenproporex (INN) and its salts; methadone (INN) intermediate (4- cyano-2-dimethylamino-4,4-diphenylbutane)kgfreefreefreefree
2926.409- alpha-Phenylacetoacetonitrilekgfreefreefreefree
2926.901- Otherkgfreefreefreefree
2927.004Diazo-, azo- or azoxy-compoundskgfreefreefreefree
2928.008Organic derivatives of hydrazine or of hydroxylaminekgfreefreefreefree
29.29Compounds with other nitrogen function:
2929.106- Isocyanateskgfreefreefreefree
2929.90- Other:
2929.90.109-- Calcium cyclamate; sodium cyclamatekgfreefreefreefree
2929.90.207-- N,N-Dialkyl (methyl, ethyl, n-propyl or isopropyl) phosphoramidic dihalideskgfreefreefreefree
2929.90.304-- Dialkyl (methyl, ethyl, n-propyl or isopropyl) N,N-dialkyl (methyl, ethyl, n-propyl or isopropyl) phosphoramidateskgfreefreefreefree
2929.90.908-- Otherkgfreefreefreefree
Chapter 10
Organo-inorganic Compounds, Heterocyclic Compounds, Nucleic Acids and their Salts, and Sulphonamides
HeadingCDDescriptionUnitGeneralEUEFTASADC
29.30Organo-sulphur compounds:
2930.200- Thiocarbamates and dithiocarbamateskgfreefreefreefree
2930.30- Thiuram mono-, di- or tetrasulphides:
2930.30.102-- Containing by mass 15% or more of thiuramkgfreefreefreefree
2930.30.900-- Otherkgfreefreefreefree
2930.407- Methioninekgfreefreefreefree
2930.609- 2-(N,N-Diethylamino)ethanethiolkgfreefreefreefree
2930.703- Bis(2-hydroxyethyl)sulfide (thiodiglycol (INN))kgfreefreefreefree
2930.80- Aldicarb (ISO), captafol (ISO) and methamidophos (ISO):
2930.80.105-- Aldicarb (ISO)kgfreefreefreefree
2930.80.202-- Captafol (ISO)kgfreefreefreefree
2930.80.304-- Methamidophos (ISO)kgfreefreefreefree
2930.90- Other:
2930.90.010-- [S-2-(dialkyl (methyl, ethyl, n-propyl or isopropyl) amino) ethyl] hydrogen a lky l (methy l , e thy l , n-propy l or isopropy l) phosphonothioates and their O-alkyl (including cycloalkyl) esters; alkylated or protonated salts thereofkgfreefreefreefree
2930.90.037-- 2-Chloroethylchloromethylsulphidekgfreefreefreefree
2930.90.053-- Bis (2-chloroethyl) sulphidekgfreefreefreefree
2930.90.073-- Bis (2-chloroethylthio) methanekgfreefreefreefree
2930.90.096-- 1,2-Bis (2-chloroethylthio) ethanekgfreefreefreefree
2930.90.118-- 1,3-Bis (2-chloroethylthio)-n-propanekgfreefreefreefree
2930.90.134-- 1,4-Bis (2-chloroethylthio)-n-butanekgfreefreefreefree
2930.90.150-- 1,5-Bis (2-chloroethylthio)-n-pentanekgfreefreefreefree
2930.90.177-- Bis (2-chloroethylthiomethyl) etherkgfreefreefreefree
2930.90.193-- Bis (2-chloroethylthioethyl) etherkgfreefreefreefree
2930.90.215-- O,O-Diethyl S-[2-(diethylamino)ethyl] phosphorothioate and its alkylated or protonated saltskgfreefreefreefree
2930.90.231-- N,N-Dialkyl (methyl, ethyl, n-propyl or isopropyl) aminoethane-2- thiols and their protonated saltskgfreefreefreefree
2930.90.258-- Thiodiglycol (INN) (bis(2-hydroxyethyl) sulphidekgfreefreefreefree
2930.90.274-- O-Ethyl S-phenyl ethylphosphonothiolothionate (fonofos)kgfreefreefreefree
2930.90.290-- Other, containing a phosphorus atom to which is bonded one methyl, ethyl, n-propyl or isopropyl group but not further carbon atomskgfreefreefreefree
2930.90.304-- Dithiocarbonates (xanthates)kg10%freefreefree
2930.90.908-- Otherkgfreefreefreefree
29.31Other organo-inorganic compounds:
2931.108- Tetramethyl lead and tetraethyl leadkgfreefreefreefree
2931.20- Tributyltin compounds:
2931.20.101-- Tributyltin oxidekgfreefreefreefree
2931.20.209-- Tributyltin fluoridekgfreefreefreefree
2931.20.306-- Tributyltin methacrylatekgfreefreefreefree
2931.20.403-- Tributyltin benzoatekgfreefreefreefree
2931.20.500-- Tributyltin chloridekgfreefreefreefree
2931.20.608-- Tributyltin linoleatekgfreefreefreefree
2931.20.705-- Tributyltin naphthenatekgfreefreefreefree
2931.3- Other organo-phosphorous derivatives:
2931.315-- Dimethyl methylphosphonatekgfreefreefreefree
2931.321-- Dimethyl propylphosphonatekgfreefreefreefree
2931.338-- Diethyl ethylphosphonatekgfreefreefreefree
2931.344-- Sodium 3-(trihydroxysilyl)propyl methylphosphonatekgfreefreefreefree
2931.350-- 2,4,6-Tripopyl-1,3,5,2,4,6-trioxatriphosphinane 2,4,6-trioxidekgfreefreefreefree
2931.367-- (5-Ethyl-2-methyl-2-oxido-1,3,2-dioxaphosphinan-5-yl)methyl methyl methylphosphonatekgfreefreefreefree
2931.373-- Bis[(5-ethyl-2-methyl-2-oxido-1,3,2-dioxaphosphinan-5-yl)methyl] methylphosphonatekgfreefreefreefree
2931.384-- Salt of methylphosphonic acid and (aminoiminomethyl)urea (1:1)kgfreefreefreefree
2931.396-- Otherkgfreefreefreefree
2931.90- Other:
2931.90.103-- O-Alkyl (including cycloalkyl) alkyl (methyl, ethyl, n-propyl or isopropyl) phosphonofluoridateskgfreefreefreefree
2931.90.154-- O-Alkyl (including cycloalkyl) N,N-dialkyl (methyl, ethyl, n-propyl or isopropyl) phosphoramidocyanidateskgfreefreefreefree
2931.90.200-- 2-Chlorovinyldichloroarsinekgfreefreefreefree
2931.90.251-- Bis (2-chlorovinyl) chloroarsinekgfreefreefreefree
2931.90.308-- Tris (2-chlorovinyl) arsinekgfreefreefreefree
2931.90.359-- Alkyl (methyl, ethyl, n-propyl or isopropyl) phosphonyl difluorideskgfreefreefreefree
2931.90.405-- [O-2-(dialkyl (methyl, ethyl, n-propyl or isopropyl)amino)ethyl] hydrogen alkyl (methyl, ethyl, n-propyl or isopropyl) phosphonites and their O-alkyl (including cycloalkyl) esters; alkylated or protonated salts thereofkgfreefreefreefree
2931.90.456-- O-Isopropyl methylphosphonochloridatekgfreefreefreefree
2931.90.502-- O-Pinacolyl methylphosphonochloridatekgfreefreefreefree
2931.90.553-- Other, containing a phosphorus atom to which is bonded one methyl, ethyl, n-propyl or isopropyl group but no further carbon atomskgfreefreefreefree
2931.90.901-- Otherkgfreefreefreefree
29.32Heterocyclic compounds with oxygen hetero-atom(s) only:
2932.1- Compounds containing an unfused furan ring (whether or not hydrogenated) in the structure:
2932.117-- Tetrahydrofurankgfreefreefreefree
2932.126-- 2-Furaldehyde (furfuraldehyde)kgfreefreefreefree
2932.132-- Furfuryl alcohol and tetrahydrofurfuryl alcoholkgfreefreefreefree
2932.149-- Sucralosekgfreefreefreefree
2932.190-- Otherkgfreefreefreefree
2932.20- Lactones:
2932.20.105-- Coumarin, methylcoumarins and ethylcoumarinskgfreefreefreefree
2932.20.202-- Phenolphthalein (excluding iodophenolphthalein)kg10%freefreefree
2932.20.903-- Otherkgfreefreefreefree
2932.9- Other:
2932.916-- Isosafrolekgfreefreefreefree
2932.922-- 1-(1,3-Benzodioxol-5-yl)propan-2-onekgfreefreefreefree
2932.939-- Piperonalkgfreefreefreefree
2932.945-- Safrolekgfreefreefreefree
2932.951-- Tetrahydrocannabinols (all isomers)kgfreefreefreefree
2932.99-- Other:
2932.99.104--- Containing by mass 10% or more of carbofurankgfreefreefreefree
2932.99.902--- Otherkgfreefreefreefree
29.33Heterocyclic compounds with nitrogen hetero-atom(s) only:
2933.1- Compounds containing an unfused pyrazole ring (whether or not hydrogenated) in the structure:
2933.113-- Phenazone (antipyrin) and its derivativeskgfreefreefreefree
2933.194-- Otherkgfreefreefreefree
2933.2- Compounds containing an unfused imidazole ring (whether or not hydrogenated) in the structure:
2933.218-- Hydantoin and its derivativeskgfreefreefreefree
2933.299-- Otherkgfreefreefreefree
2933.3- Compounds containing an unfused pyridine ring (whether or not hydrogenated) in the structure:
2933.312-- Pyridine and its saltskgfreefreefreefree
2933.329-- Piperidine and its saltskgfreefreefreefree
2933.335-- Alfentanil (INN), anileridine (INN), bezitramide (INN), bromazepam (INN), difenoxin (INN), diphenoxylate (INN), dipipanone (INN), fentanyl (INN), ketobemidone (INN), methylphenidate (INN), pentazocine (INN), pethidine (INN), pethidine (INN) intermediate A, phencyclidine (INN) (PCP), phenoperidine (INN), pipradrol (INN), piritramide (INN), propiram (INN) and trimeperidine (INN); salts thereofkgfreefreefreefree
2933.39-- Other:
2933.39.100--- 3-Quinuclidinyl benzilatekgfreefreefreefree
2933.39.208--- Quinuclidine-3-olkgfreefreefreefree
2933.39.909--- Otherkgfreefreefreefree
2933.4- Compounds containing in the structure a quinoline or isoquinoline ring-system (whether or not hydrogenated), not further fused:
2933.417-- Levorphanol (INN) and its saltskgfreefreefreefree
2933.49-- Other:
2933.49.105--- Polymerised 1, 2 dihydro-2, 2, 4-trimethyl-quinolinekgfreefreefreefree
2933.49.903--- Otherkgfreefreefreefree
2933.5- Compounds containing a pyrimidine ring (whether or not hydrogenated) or piperazine ring in the structure:
2933.528-- Malonylurea (barbituric acid) and its saltskgfreefreefreefree
2933.534-- Allobarbital (INN), amobarbital (INN), barbital (INN), butalbital (INN), butobarbital (INN), cyclobarbital (INN), methylphenobarbital (INN), pentobarbital (INN), phenobarbital (INN), secbutabarbital (INN), secobarbital (INN) and vinylbital (INN); and salts thereofkgfreefreefreefree
2933.540-- Other derivatives of malonylurea (barbituric acid); salts thereofkgfreefreefreefree
2933.557-- Loprazolam (INN), mecloqualone (INN), methaqualone (INN) and zipeprol (INN); salts thereofkgfreefreefreefree
2933.59-- Other:
2933.59.101--- Trimethoprim (INN)kgfreefreefreefree
2933.59.207--- Tenoforvir disoproxil fumaratekgfreefreefreefree
2933.59.304--- Piperazine citrate; piperazine hexahydrate; piperazine adipatekg10%freefreefree
2933.59.800--- Bromaci l ; O,O-Diethyl 0-4 methyl 2 isopropylpyr imid 6 phosphorothioatekgfreefreefreefree
2933.59.851--- Other compounds of ureakg10%freefreefree
2933.59.908--- Otherkg10%freefreefree
2933.6- Compounds containing an unfused triazine ring (whether or not hydrogenated) in the structure:
2933.616-- Melaminekgfreefreefreefree
2933.69-- Other:
2933.69.201--- Cyanuric chloridekgfreefreefreefree
2933.69.309--- Atrazinekgfreefreefreefree
2933.69.406--- Simazinekgfreefreefreefree
2933.69.902--- Otherkg10%freefreefree
2933.7- Lactams:
2933.710-- 6-Hexanelactam (epsilon-caprolactam)kgfreefreefreefree
2933.727-- Clobazam (INN) and methyprylon (INN)kgfreefreefreefree
2933.791-- Other lactamskgfreefreefreefree
2933.9- Other:
2933.912-- Alprazolam (INN), camazepam (INN), chlordiazepoxide (INN), clonazepam (INN), clorazepate (INN), delorazepam (INN), diazepam (INN), estazolam (INN), ethyl loflazepate (INN), fludiazepam (INN), flunitrazepam (INN), flurazepam (INN), halazepam (INN), lorazepam (INN), lormetazepam (INN), mazindol (INN), medazepam (INN), midazolam (INN), nimetazepam (INN), nitrazepam (INN), nordazepam (INN), oxazepam (INN), pinazepam (INN), prazepam (INN), pyrovalerone (INN), temazepam (INN), tetrazepam (INN) and triazolam (INN); salts thereofkgfreefreefreefree
2933.926-- Azinphos-methyl (ISO)kgfreefreefreefree
2933.99-- Other:
2933.99.108--- Containing by mass 7 per cent or more of benomylkgfreefreefreefree
2933.99.906--- Otherkgfreefreefreefree
29.34Nucleic acids and their salts, whether or not chemically defined; other heterocyclic compounds:
2934.100- Compounds containing an unfused thiazole ring (whether or not hydrogenated) in the structurekgfreefreefreefree
2934.205- Compounds containing in the structure a benzothiazole ring-system (whether or not hydrogenated), not further fusedkgfreefreefreefree
2934.305- Compounds containing in the structure a phenothiazine ring-system (whether or not hydrogenated), not further fusedkgfreefreefreefree
2934.9- Other:
2934.913-- Aminorex (INN), brotizolam (INN), clotiazepam (INN), cloxazolam (INN), dextromoramide (INN), haloxazolam (INN), ketazolam (INN), mesocarb (INN), oxazolam (INN), pemoline (INN), phendimetrazine (INN), phenmetrazine (INN) and sufentanil (INN); salts thereofkgfreefreefreefree
2934.994-- Otherkgfreefreefreefree
29.35Sulphonamides:
2935.104- N-Methylperfluorooctane sulphonamidekgfreefreefreefree
2935.209- N-Ethylperfluorooctane sulphonamidekgfreefreefreefree
2935.303- N-Ethyl-N-(2-hydroxyethyl) perfluorooctane sulphonamidekgfreefreefreefree
2935.408- N-(2-Hydroxyethyl)-N-methylperfluorooctane sulphonamidekgfreefreefreefree
2935.502- Other perfluorooctane sulphonamideskgfreefreefreefree
2935.900- Otherkgfreefreefreefree
Chapter 11
Provitamins, Vitamins and Hormones
HeadingCDDescriptionUnitGeneralEUEFTASADC
29.36Provitamins and vitamins, natural or reproduced by synthesis (including natural concentrates), derivatives thereof used primarily as vitamins, and intermixtures of the foregoing, whether or not in any solvent:
2936.2- Vitamins and their derivatives, unmixed:
2936.219-- Vitamins A and their derivativeskgfreefreefreefree
2936.225-- Vitamin B[1] and its derivativeskgfreefreefreefree
2936.231-- Vitamin B[2] and its derivativeskgfreefreefreefree
2936.248-- D- or DL-Pantothenic acid (Vitamin B[3] or Vitamin B[5]) and its derivativeskgfreefreefreefree
2936.254-- Vitamin B[6] and its derivativeskgfreefreefreefree
2936.260-- Vitamin B[12] and its derivativeskgfreefreefreefree
2936.277-- Vitamin C and its derivativeskgfreefreefreefree
2936.283-- Vitamin E and its derivativeskgfreefreefreefree
2936.291-- Other vitamins and their derivativeskgfreefreefreefree
2936.904- Other, including natural concentrateskgfreefreefreefree
29.37Hormones, prostaglandins, thromboxanes and leukotrienes, natural or reproduced by synthesis; derivatives and structural analogues thereof, including chain modified polypeptides, used primarily as hormones:
2937.1- Polypeptide hormones, protein hormones and glycoprotein hormones, their derivatives and structural analogues:
2937.118-- Somatotropin, its derivatives and structural analogueskgfreefreefreefree
2937.124-- Insulin and its saltskgfreefreefreefree
2937.199-- Otherkgfreefreefreefree
2937.2- Steroidal hormones, their derivatives and structural analogues:
2937.212-- Cortisone, hydrocortisone, prednisone (dehydrocortisone) and prednisolone (dehydrohydrocortisone)kgfreefreefreefree
2937.229-- Halogenated derivatives of corticosteroidal hormoneskgfreefreefreefree
2937.235-- Oestrogens and progestogenskgfreefreefreefree
2937.293-- Otherkgfreefreefreefree
2937.502- Prostaglandins, thromboxanes and leukotrienes, their derivatives and structural analogueskgfreefreefreefree
2937.90- Other:
2937.90.105-- Epinephrinekgfreefreefreefree
2937.90.202-- Other catecholamine hormones, their derivatives and structural analogueskgfreefreefreefree
2937.90.309-- Amino-acid derivativeskgfreefreefreefree
2937.90.903-- Otherkgfreefreefreefree
Chapter 12
Glycosides and Alkaloids, Natural or Reproduced By Synthesis, and their Salts, Ethers, Esters and Other Derivatives
HeadingCDDescriptionUnitGeneralEUEFTASADC
29.38Glycosides, natural or reproduced by synthesis, and their salts, ethers, esters and other derivatives:
2938.105- Rutoside (rutin) and its derivativeskgfreefreefreefree
2938.901- Otherkgfreefreefreefree
29.39Alkaloids, natural or reproduced by synthesis, and their salts, ethers, esters and other derivatives:
2939.1- Alkaloids of opium and their derivatives; salts thereof:
2939.11-- Concentrates of poppy straw; buprenorphine (INN), codeine, dihydrocodeine (INN), ethylmorphine, etorphine (INN), heroin, hydrocodone (INN), hydromorphone (INN), morphine, nicomorphine (INN), oxycodone (INN), oxymorphone (INN), pholcodine (INN), thebacon (INN) and thebaine; salts thereof:
2939.11.102--- Codeine phosphatekg5%5%5%free
2939.11.900--- Otherkgfreefreefreefree
2939.196-- Otherkgfreefreefreefree
2939.203- Alkaloids of cinchona and their derivatives; salts thereofkgfreefreefreefree
2939.308- Caffeine and its saltskgfreefreefreefree
2939.4- Ephedrines and their salts:
2939.419-- Ephedrine and its saltskgfreefreefreefree
2939.425-- Pseudoephedrine (INN) and its saltskgfreefreefreefree
2939.431-- Cathine (INN) and its saltskgfreefreefreefree
2939.448-- Norephedrine and its saltskgfreefreefreefree
2939.498-- Otherkgfreefreefreefree
2939.5- Theophylline and aminophylline (theophylline-ethylenediamine) and their derivatives; salts thereof:
2939.513-- Fenetylline (INN) and its saltskgfreefreefreefree
2939.594-- Otherkgfreefreefreefree
2939.6- Alkaloids of rye ergot and their derivatives; salts thereof:
2939.618-- Ergometrine (INN) and its saltskgfreefreefreefree
2939.624-- Ergotamine (INN) and its saltskgfreefreefreefree
2939.630-- Lysergic acid and its saltskgfreefreefreefree
2939.699-- Otherkgfreefreefreefree
2939.7- Other, of vegetal origin:
2939.712-- Cocaine, ecgonine, levometamfetamine (INN) , metamfetamine (INN), metamfetamine racemate; salts, esters and other derivatives thereofkgfreefreefreefree
2939.79-- Other:
2939.79.100--- Scopolamine (hyoscine) and its derivativeskg10%freefreefree
2939.79.208--- Theobromine; emetinekg10%freefreefree
2939.79.909--- Otherkgfreefreefreefree
2939.800- Otherkgfreefreefreefree
Chapter 13
Other Organic Compounds

Additonal Note

1.

For the purposes of heading 29.41, when imported:

(a)

Medicaments for veterinarian use shall comply with section 16 of the Fertilizer, Farm Feeds, Agricultural Remedies and Stock Remedies Act No. 36 of 1947.

HeadingCDDescriptionUnitGeneralEUEFTASADC
2940.004Sugars, chemically pure (excluding sucrose, lactose, maltose, glucose and fructose); sugar ethers, sugar acetals and sugar esters, and their salts (excluding products of heading 29.37, 29.38 or 29.39)kgfreefreefreefree
29.41Antibiotics:
2941.10- Penicillins and their derivatives with a penicillanic acid structure; salts thereof:
2941.10.1-- Broad spectrum penicillins:
2941.10.118--- For human usekgfreefreefreefree
2941.10.126--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
2941.10.2-- Narrow spectrum penicillins:
2941.10.215--- For human usekgfreefreefreefree
2941.10.223--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
2941.20- Streptomycins and their derivatives; salts thereof:
2941.20.104-- For human usekgfreefreefreefree
2941.20.201-- For veterinary use, as defined in additional Note 1kgfreefreefreefree
2941.30- Tetracyclines and their derivatives; salts thereof:
2941.30.109-- For human usekgfreefreefreefree
2941.30.206-- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
2941.40- Chloramphenicol and its derivatives; salts thereof:
2941.40.103-- For human usekgfreefreefreefree
2941.40.200-- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
2941.50- Erythromycin and its derivatives; salts thereof:
2941.50.108-- For human usekgfreefreefreefree
2941.50.205-- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
2941.90- Other:
2941.90.1-- Other Macrolides:
2941.90.114--- For human usekgfreefreefreefree
2941.90.122--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
2941.90.2-- Cephalosporins:
2941.90.211--- For human usekgfreefreefreefree
2941.90.222--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
2941.90.3-- Trimethoprim:
2941.90.319--- For human usekgfreefreefreefree
2941.90.327--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
2941.90.4-- Fluoroquinolones:
2941.90.416--- For human usekgfreefreefreefree
2941.90.424--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
2941.90.5-- Aminoglycosides:
2941.90.513--- For human usekgfreefreefreefree
2941.90.521--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
2941.90.6-- Other betalactams:
2941.90.610--- For human usekgfreefreefreefree
2941.90.629--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
2941.90.7-- Other antibacterials:
2941.90.718--- For human usekgfreefreefreefree
2941.90.726--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
2941.90.8-- Sulphonamides:
2941.90.815--- For human usekgfreefreefreefree
2941.90.823--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
2942.001Other organic compoundskgfreefreefreefree
Chapter 30
Pharmaceutical Products

Notes

1.

This Chapter does not cover the following:

(a)

foods or beverages (such as dietetic, diabetic or fortified foods, food supplements, tonic beverages and mineral waters) (excluding nutritional preparations for intravenous administration) (Section IV);

(b)

preparations, such as tablets, chewing gum or patches (transdermal systems), intended to assist smokers to stop smoking (heading 21.06 or 38.24);

(c)

plasters specially calcined or finely ground for use in dentistry (heading 25.20);

(d)

aqueous distillates or aqueous solutions of essential oils, suitable for medicinal uses (heading 33.01);

(e)

preparations of headings 33.03 to 33.07, even if they have therapeutic or prophylactic properties;

(f)

soap or other products of heading 34.01 containing added medicaments;

(g)

preparations with a basis of plaster for use in dentistry (heading 34.07); or

(h)

blood albumin not prepared for therapeutic or prophylactic uses (heading 35.02).

2.

For the purposes of heading 30.02, the expression "immunological products" applies to peptides and proteins (other than goods of heading 29.37) which are directly involved in the regulation of immunological processes, such as monoclonal antibodies (MAB), antibody fragments, antibody conjugates and antibody fragment conjugates, interleukins, interferons (IFN), chemokines and certain tumor necrosis factors (TNF), growth factors (GF), hematopoietins and colony stimulating factors (CSF).

3.

For the purposes of headings 30.03 and 30.04 and of Note 4(d) to this Chapter, the following are to be treated:

(a)

as unmixed products:

(1)

unmixed products dissolved in water;

(2)

all goods of Chapter 28 or 29; and

(3)

simple vegetable extracts of heading 13.02, merely standardised or dissolved in any solvent;

(b)

as products which have been mixed:

(1)

colloidal solutions and suspensions (excluding colloidal sulphur);

(2)

vegetable extracts obtained by the treatment of mixtures of vegetable materials; and

(3)

salts and concentrates obtained by evaporating natural mineral waters.

4.

Heading 30.06 applies only to the following, which are to be classified in that heading and in no other heading of this Schedule:

(a)

sterile surgical catgut, similar sterile suture materials (including sterile absorbable surgical or dental yarns) and sterile tissue adhesives for surgical wound closure;

(b)

sterile laminaria and sterile laminaria tents;

(c)

sterile absorbable surgical or dental haemostatics; sterile surgical or dental adhesion barriers, whether or not absorbable;

(d)

opacifying preparations for X-ray examinations and diagnostic reagents designed to be administered to the patient, being unmixed products put up in measured doses or products consisting of two or more ingredients which have been mixed together for such uses;

(e)

blood-grouping reagents;

(f)

dental cements and other dental fillings; bone reconstruction cements;

(g)

first-aid boxes and kits;

(h)

chemical contraceptive preparations based on hormones, on other products of heading 29.37 or on spermicides;

(ij)

gel preparations designed to be used in human or veterinary medicine as a lubricant for parts of the body for surgical operations or physical examinations or as a coupling agent between the body and medical instruments;

(k)

waste pharmaceuticals, that is, pharmaceutical products which are unfit for their original intended purpose due to, for example, expiry of shelf life; and

(l)

appliances identifiable for ostomy use, that is, colostomy, ileostomy and urostomy pouches cut to shape and their adhesive wafers or faceplates.

Subheading Notes

1.

For the purposes of subheadings 3002.13 and 3002.14, the following are to be treated:

(a)

As unmixed products, pure products, whether or not containing impurities;

(b)

As products which have been mixed:

(1)

The products mentioned in (a) above dissolved in water or in other solvents;

(2)

The products mentioned in (a) and (b)(1) above with an added stabiliser necessary for their preservation or transport; and

(3)

The products mentioned in (a), (b)(1) and (b)(2) above with any other additive.

2.

Subheadings 3003.60 and 3004.60 cover medicaments containing artemisinin (INN) for oral ingestion combined with other pharmaceutical active ingredients, or containing any of the following active principles, whether or not combined with other pharmaceutical active ingredients: amodiaquine (INN); artelinic acid or its salts; artenimol (INN); artemotil (INN); artemether (INN); artesunate (INN), chloroquine (INN); dihydroartemisinin (INN); lumefantrine (INN); mefloquine (INN); piperaquine (INN); pyrimethamine (INN) or sulfadoxine (INN)

Additional Note

1.

For the purposes of headings 3003.10,

(a)

Medicaments for veterinarian use shall comply with section 16 of the Fertilizer, Farm Feeds, Agricultural Remedies and Stock Remedies Act No. 36 of 1947.

HeadingCDDescriptionUnitGeneralEUEFTASADC
30.01Glands and other organs for organo-therapeutic uses, dried, whether or not powdered; extracts of glands or other organs or of their secretions for organo-therapeutic uses; heparin and its salts; other human or animal substances prepared for therapeutic or prophylactic uses, not elsewhere specified or included:
3001.208- Extracts of glands or other organs or of their secretionskgfreefreefreefree
3001.903- Otherkgfreefreefreefree
30.02Human blood; animal blood prepared for therapeutic, prophylactic or diagnostic uses; antisera, other blood fractions and immunological products, whether or not modified or obtained by means of biotechnological processes; vaccines, toxins, cultures of micro-organisms (excluding yeasts) and similar products:
3002.1- Antisera, other blood fractions and immunological products, whether or not modified or obtained by means of biotechnological processes:
3002.113-- Malaria diagnostic test kitskgfreefreefreefree
3002.126-- Antisera and other blood fractionskgfreefreefreefree
3002.136-- Immunological products, unmixed, not put up in measured doses or in forms or packings for retail salekgfreefreefreefree
3002.142-- Immunological products, mixed, not put up in measured doses or in forms or packings for retail salekgfreefreefreefree
3002.159-- Immunological products, put up in measured doses or in forms or packings for retail salekgfreefreefreefree
3002.194-- Otherkgfreefreefreefree
3002.201- Vaccines for human medicinekgfreefreefreefree
3002.306- Vaccines for veterinary medicinekgfreefreefreefree
3002.90- Other:
3002.90.100-- Saxitoxinkgfreefreefreefree
3002.90.208-- Ricinkgfreefreefreefree
3002.90.909-- Otherkgfreefreefreefree
30.03Medicaments (excluding goods of heading 30.02, 30.05 or 30.06) consisting of two or more constituents which have been mixed together for therapeutic or prophylactic uses, not put up in measured doses or in forms or packings for retail sale:
3003.10- Containing penicillins or derivatives thereof, with a penicillanic acid structure, or streptomycins or their derivatives:
3003.10.1-- Broad spectrum penicillins:
3003.10.116--- For human usekgfreefreefreefree
3003.10.124--- For veterinary use, as defined in additional Note 1kgfreefreefreefree
3003.10.2-- Narrow spectrum penicillins:
3003.10.213--- For human usekgfreefreefreefree
3003.10.221--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3003.10.302-- Otherkgfreefreefreefree
3003.20- Other, containing antibiotics:
3003.20.1-- Tetracyclines:
3003.20.110--- For human usekgfreefreefreefree
3003.20.129--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3003.20.2-- Chloramphenicol:
3003.20.218--- For human usekgfreefreefreefree
3003.20.226--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3003.20.3-- Cephalosporins:
3003.20.315--- For human usekgfreefreefreefree
3003.20.323--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3003.20.4-- Trimethoprim:
3003.20.412--- For human usekgfreefreefreefree
3003.20.420--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3003.20.5-- Macrolides:
3003.20.514--- For human usekgfreefreefreefree
3003.20.528--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3003.20.6-- Fluoroquinolones:
3003.20.617--- For human usekgfreefreefreefree
3003.20.625--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3003.20.7-- Aminoglycosides:
3003.20.714--- For human usekgfreefreefreefree
3003.20.722--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3003.20.8-- Other betalactams:
3003.20.811--- For human usekgfreefreefreefree
3003.20.823--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3003.20.9-- Other antibacterials:
3003.20.919--- For human usekgfreefreefreefree
3003.20.927--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3003.3- Other, containing hormones or other products of heading 29.37:
3003.316-- Containing insulinkgfreefreefreefree
3003.397-- Otherkgfreefreefreefree
3003.4- Other, containing alkaloids or derivatives thereof:
3003.410-- Containing ephedrine or its saltskgfreefreefreefree
3003.427-- Containing pseudoephedrine (INN) or its saltskgfreefreefreefree
3003.433-- Containing norephedrine or its saltskgfreefreefreefree
3003.49-- Other:
3003.49.109--- Containing codeine phosphatekgfreefreefreefree
3003.49.907--- Otherkgfreefreefreefree
3003.603- Other, containing antimalarial active principles described in Subheading Note 2 to this Chapterkgfreefreefreefree
3003.907- Otherkgfreefreefreefree
30.04Medicaments (excluding goods of heading 30.02, 30.05 or 30.06) consisting of mixed or unmixed products for therapeutic or prophylactic uses, put up in measured doses (including those in the form of transdermal administration systems) or in forms or packings for retail sale:
3004.10- Containing penicillins or derivatives thereof, with a penicillanic acid structure, or streptomycins or their derivatives:
3004.10.1-- In aerosol containers:
3004.10.115--- Broad spectrum penicillinkgfreefreefreefree
3004.10.128--- Narrow spectrum penicillinkgfreefreefreefree
3004.10.2-- Other broad spectrum penicillins:
3004.10.217--- For human usekgfreefreefreefree
3004.10.225--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3004.10.3-- Other narrow spectrum penicillins:
3004.10.314--- For human usekgfreefreefreefree
3004.10.322--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3004.10.9-- Other:
3004.10.918--- For human usekgfreefreefreefree
3004.10.926--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3004.20- Other, containing antibiotics:
3004.20.1-- In aerosol containers:
3004.20.106--- In aerosol containerskgfreefreefreefree
3004.20.2-- Tetracyclines:
3004.20.211--- For human usekgfreefreefreefree
3004.20.224--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3004.20.3-- Chloramphenicol:
3004.20.319--- For human usekgfreefreefreefree
3004.20.327--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3004.20.4-- Cephalosporins:
3004.20.416--- For human usekgfreefreefreefree
3004.20.424--- For veterinary use, as defined Additional Note 1kgfreefreefreefree
3004.20.5-- Trimethoprim:
3004.20.513--- For human usekgfreefreefreefree
3004.20.521--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3004.20.6-- Macrolides:
3004.20.610--- For human usekgfreefreefreefree
3004.20.629--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3004.20.7-- Fluoroquinolones:
3004.20.718--- For human usekgfreefreefreefree
3004.20.726--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3004.20.8-- Aminoglycosides:
3004.20.815--- For human usekgfreefreefreefree
3004.20.823--- For veterinary use, as defined in Additional Note 1kgfreefreefreefree
3004.20.9-- Other:
3004.20.904--- Otherkgfreefreefreefree
3004.20.912--- Other betalactams for human usekgfreefreefreefree
3004.20.920--- Other betalactams for veterinary use, as defined in Additional Note 1kgfreefreefreefree
3004.20.939--- Other antibacterials for human usekgfreefreefreefree
3004.20.947--- Other antibacterials for veterinary use, as defined in Additional Note 1kgfreefreefreefree
3004.20.998--- Otherkgfreefreefreefree
3004.3- Other, containing hormones or other products of heading 29.37:
3004.31-- Containing insulin:
3004.31.107--- In aerosol containerskgfreefreefreefree
3004.31.905--- Otherkgfreefreefreefree
3004.32-- Containing corticosteroid hormones, their derivatives or structural analogues:
3004.32.103--- In aerosol containerskgfreefreefreefree
3004.32.901--- Otherkgfreefreefreefree
3004.39-- Other:
3004.39.108--- In aerosol containerskgfreefreefreefree
3004.39.906--- Otherkgfreefreefreefree
3004.4- Other, containing alkaloids or derivatives thereof:
3004.41-- Containing ephedrine or its salts:
3004.41.101--- In aerosol containerskgfreefreefreefree
3004.41.901--- Otherkgfreefreefreefree
3004.42-- Containing pseudoephedrine (INN) or its salts:
3004.42.108--- In aerosol containerskgfreefreefreefree
3004.42.906--- Otherkgfreefreefreefree
3004.43-- Containing norephedrine or its salts:
3004.43.104--- In aerosol containerskgfreefreefreefree
3004.43.902--- Otherkgfreefreefreefree
3004.49-- Other:
3004.49.056--- In aerosol containerskgfreefreefreefree
3004.49.102--- Other, containing codeine phosphatekgfreefreefreefree
3004.49.900--- Otherkgfreefreefreefree
3004.50- Other, containing vitamins or other products of heading 29.36:
3004.50.103-- In aerosol containerskgfreefreefreefree
3004.50.908-- Otherkgfreefreefreefree
3004.607- Other, containing antimalarial active principles described in Subheading Note 2 to this Chapterkgfreefreefreefree
3004.90- Other:
3004.90.108-- In aerosol containerskgfreefreefreefree
3004.90.906-- Otherkgfreefreefreefree
30.05Wadding, gauze, bandages and similar articles (for example, dressings, adhesive plasters, poultices), impregnated or coated with pharmaceutical substances or put up in forms or packings for retail sale for medical, surgical, dental or veterinary purposes:
3005.10- Adhesive dressings and other articles having an adhesive layer:
3005.10.105-- Adhesive bandageskg10%freefreefree
3005.10.903-- Otherkgfreefreefreefree
3005.90- Other:
3005.90.101-- Absorbent gauze or muslin; bandages (excluding those manufactured from polyurethane resins and woven fabrics of glass fibre); boric and other absorbent lint; gauze or muslin swabs (including those containing X-ray detectable thread or tape)kg20%freefreefree
3005.90.908-- Otherkgfreefreefreefree
30.06Pharmaceutical goods specified in Note 4 to this Chapter:
3006.101- Sterile surgical catgut, similar sterile suture materials (including sterile absorbable surgical or dental yarns) and sterile tissue adhesives for surgical wound closure; sterile laminaria and sterile laminaria tents; sterile absorbable surgical or dental haemostatics; sterile surgical or dental adhesion barriers, whether or not absorbablekgfreefreefreefree
3006.206- Blood-grouping reagentskgfreefreefreefree
3006.300- Opacifying preparations for X-ray examinations; diagnostic reagents designed to be administered to the patientkgfreefreefreefree
3006.405- Dental cements and other dental fillings; bone reconstruction cementskgfreefreefreefree
3006.502- First-aid boxes and kitskgfreefreefreefree
3006.604- Chemical contraceptive preparations based on hormones, on other products of heading 29.37 or on spermicideskgfreefreefreefree
3006.709- Gel preparations designed to be used in human or veterinary medicine as a lubricant for parts of the body for surgical operations or physical examinations or as a coupling agent between the body and medical instrumentskgfreefreefreefree
3006.9- Other:
3006.914-- Appliances identifiable for ostomy usekgfreefreefreefree
3006.920-- Waste pharmaceuticalskgfreefreefreefree
Chapter 31
Fertilizers

Notes

1.

This Chapter does not cover the following:

(a)

animal blood of heading 05.11;

(b)

separate chemically defined compounds (excluding those answering to the descriptions in Note 2(a), 3(a), 4(a) or 5 below); or

(c)

cultured potassium chloride crystals (excluding optical elements) with a mass of not less than 2,5 g each, of heading 38.24; optical elements of potassium chloride (heading 90.01).

2.

Heading 31.02 applies only to the following goods, provided that they are not put up in the forms or packages described in heading 31.05:

(a)

Goods which answer to one or other of the descriptions given below:

(i)

sodium nitrate, whether or not pure;

(ii)

ammonium nitrate, whether or not pure;

(iii

double salts, whether or not pure, of ammonium sulphate and ammonium nitrate;

(iv)

ammonium sulphate, whether or not pure;

(v)

double salts (whether or not pure) or mixtures of calcium nitrate and ammonium nitrate;

(vi)

double salts (whether or not pure) or mixtures of calcium nitrate and magnesium nitrate;

(vii

calcium cyanamide, whether or not pure or treated with oil;

(vii

urea, whether or not pure.

(b)

Fertilisers consisting of any of the goods described in (a) above mixed together.

(c)

Fertilisers consisting of ammonium chloride or of any of the goods described in (a) or (b) above mixed with chalk, gypsum or other inorganic non-fertilising substances.

(d)

Liquid fertilisers consisting of the goods of subparagraph (a)(ii) or (viii) above, or of mixtures of those goods, in an aqueous or ammoniacal solution.

3.

Heading 31.03 applies only to the following goods, provided that they are not put up in the forms or packages described in heading 31.05:

(a)

Goods which answer to one or other of the descriptions given below:

(i)

basic slag;

(ii)

natural phosphates of heading 25.10, calcined or further heat-treated than for the removal of impurities;

(iii

superphosphates (single, double or triple);

(iv)

calcium hydrogenorthophosphate containing not less than 0,2 per cent by mass of fluorine calculated on the dry anhydrous product.

(b)

Fertilisers consisting of any of the goods described in (a) above mixed together, but with no account being taken of the fluorine content limit.

(c)

Fertilisers consisting of any of the goods described in (a) or (b) above, but with no account being taken of the fluorine content limit, mixed with chalk, gypsum or other inorganic non-fertilising substances.

4.

Heading 31.04 applies only to the following goods, provided that they are not put up in the forms or packages described in heading 31.05:

(a)

Goods which answer to one or other of the descriptions given below:

(i)

crude natural potassium salts (for example, carnallite, kainite and sylvite);

(ii)

potassium chloride, whether or not pure, except as provided in Note 1(c) above;

(iii

potassium sulphate, whether or not pure;

(iv)

magnesium potassium sulphate, whether or not pure.

(b)

Fertilizers consisting of any of the goods described in (a) above mixed together.

5.

Ammonium dihydrogenorthophosphate (monoammonium phosphate) and diammonium hydrogenorthophosphate (diammonium phosphate), whether or not pure, and intermixtures thereof, are to be classified in heading 31.05.

6.

For the purposes of heading 31.05, the term "other fertilisers" applies only to products of a kind used as fertilisers and containing, as an essential constituent, at least one of the fertilising elements nitrogen, phosphorus or potassium.

HeadingCDDescriptionUnitGeneralEUEFTASADC
3101.000Animal or vegetable fertilisers, whether or not mixed together or chemically treated; fertilisers produced by the mixing or chemical treatment of animal or vegetable productskgfreefreefreefree
31.02Mineral or chemical fertilizers, nitrogenous:
3102.109- Urea, whether or not in aqueous solutionkgfreefreefreefree
3102.2- Ammonium sulphate; double salts and mixtures of ammonium sulphate and ammonium nitrate:
3102.215-- Ammonium sulphatekgfreefreefreefree
3102.290-- Otherkgfreefreefreefree
3102.308- Ammonium nitrate, whether or not in aqueous solutionkgfreefreefreefree
3102.402- Mixtures of ammonium nitrate with calcium carbonate or other inorganic non-fertilising substanceskgfreefreefreefree
3102.507- Sodium nitratekgfreefreefreefree
3102.601- Double salts and mixtures of calcium nitrate and ammonium nitratekgfreefreefreefree
3102.800- Mixtures of urea and ammonium nitrate in aqueous or ammoniacal solutionkgfreefreefreefree
3102.905- Other, including mixtures not specified in the foregoing subheadingskgfreefreefreefree
31.03Mineral or chemical fertilisers, phosphatic:
3103.1- Superphosphates:
3103.119-- Containing by mass 35 per cent or more of diphosphorous pentaoxide (P O ) 2 5kgfreefreefreefree
3103.192-- Otherkgfreefreefreefree
3103.909- Otherkgfreefreefreefree
31.04Mineral or chemical fertilisers, potassic:
3104.200- Potassium chloridekgfreefreefreefree
3104.305- Potassium sulphatekgfreefreefreefree
3104.902- Otherkgfreefreefreefree
31.05Mineral or chemical fertilisers containing two or three of the fertilising elements nitrogen, phosphorus and potassium; other fertilizers; goods of this chapter in tablets or similar forms or in packages of a gross mass not exceeding 10 kg:
3105.104- Goods of this Chapter in tablets or similar forms or in packages of a gross mass not exceeding 10 kgkgfreefreefreefree
3105.204- Mineral or chemical fertilisers containing the three fertilising elements nitrogen, phosphorus and potassiumkgfreefreefreefree
3105.309- Diammonium hydrogenorthophosphate (diammonium phosphate)kgfreefreefreefree
3105.403- Ammonium dihydrogenorthophosphate (mono-ammonium phospha te ) and mix tu res the reo f w ith d iammon ium hyd rogeno r thophospha te (d iammon ium phospha te )kgfreefreefreefree
3105.5- Other mineral or chemical fertilisers containing the two fertilising elements nitrogen and phosphorus:
3105.514-- Containing nitrates and phosphateskgfreefreefreefree
3105.595-- Otherkgfreefreefreefree
3105.602- Mineral or chemical fertilisers containing the two fertilising elements phosphorus and potassiumkgfreefreefreefree
3105.906- Otherkgfreefreefreefree
Chapter 32
Tanning or Dyeing Extracts; Tannins and their Derivatives; Dyes, Pigments and Other Colouring Matter; Paints and Varnishes; Putty and Other Mastics; Inks

Notes

1.

This Chapter does not cover the following:

(a)

separate chemically defined elements or compounds (excluding those of heading 32.03 or 32.04, inorganic products of a kind used as luminophores (heading 32.06), glass obtained from fused quartz or other fused silica in the forms provided for in heading 32.07, and also dyes and other colouring matter put up in forms or packings for retail sale, of heading 32.12);

(b)

tannates and other tannin derivatives of products of headings 29.36 to 29.39, 29.41 or 35.01 to 35.04; or

(c)

mastics of asphalt or other bituminous mastics (heading 27.15).

2.

Heading 32.04 includes mixtures of stabilised diazonium salts and couplers for the production of azo dyes.

3.

Headings 32.03, 32.04, 32.05 and 32.06 apply also to preparations based on colouring matter (including, in the case of heading 32.06, colouring pigments of heading 25.30 or Chapter 28, metal flakes and metal powders), of a kind used for colouring any material or used as ingredients in the manufacture of colouring preparations.The headings do not apply, however, to pigments dispersed in non-aqueous media, in liquid or paste form, of a kind used in the manufacture of paints, including enamels (heading 32.12), or to other preparations of heading 32.07, 32.08, 32.09, 32.10, 32.12, 32.13 or 32.15.

4.

Heading 32.08 includes solutions (excluding collodions) consisting of any of the products specified in headings 39.01 to 39.13 in volatile organic solvents when the mass of the solvent exceeds 50 per cent of the mass of the solution.

5.

The expression "colouring matter" in this Chapter does not include products of a kind used as extenders in oil paints, whether or not they are also suitable for colouring distempers.

6.

The expression "stamping foils" in heading 32.12 applies only to thin sheets of a kind used for printing, for example, book covers or hat bands, and consisting of:

(a)

metallic powder (including powder of precious metal) or pigment, agglomerated with glue, gelatin or other binder; or

(b)

metal (including precious metal) or pigment, deposited on a supporting sheet of any material.

HeadingCDDescriptionUnitGeneralEUEFTASADC
32.01Tanning extracts of vegetable origin; tannins and their salts, ethers, esters and other derivatives:
3201.107- Quebracho extractkgfreefreefreefree
3201.201- Wattle extractkgfreefreefreefree
3201.903- Otherkgfreefreefreefree
32.02Synthetic organic tanning substances; inorganic tanning substances; tanning preparations, whether or not containing natural tanning substances; enzymatic preparations for pre-tanning:
3202.100- Synthetic organic tanning substanceskgfreefreefreefree
3202.907- Otherkgfreefreefreefree
3203.005Colouring matter of vegetable or animal origin (including dyeing extracts but excluding animal black), whether or not chemically defined; preparations as specified in Note 3 to this Chapter based on colouring matter of vegetable or animal originkgfreefreefreefree
32.04Synthetic organic colouring matter, whether or not chemically defined; preparations as specified in Note 3 to this Chapter based on synthetic organic colouring matter; synthetic organic products of a kind used as fluorescent brightening agents or as luminophores, whether or not chemically defined:
3204.1- Synthetic organic colouring matter and preparations based thereon as specified in Note 3 to this Chapter:
3204.114-- Disperse dyes and preparations based thereonkgfreefreefreefree
3204.120-- Acid dyes, whether or not premetallised, and preparations based thereon; mordant dyes and preparations based thereonkgfreefreefreefree
3204.137-- Basic dyes and preparations based thereonkgfreefreefreefree
3204.143-- Direct dyes and preparations based thereonkgfreefreefreefree
3204.152-- Vat dyes (including those usable in that state as pigments) and preparations based thereonkgfreefreefreefree
3204.166-- Reactive dyes and preparations based thereonkgfreefreefreefree
3204.17-- Pigments and preparations based thereon:
3204.17.101--- Azo pigments of the following description and International Colour Index Numbers:- C.I. Pigment, Yellow 1, No. 11680- C.I. Pigment, Yellow 3, No. 11710- C.I. Pigment, Yellow 12, No. 21090- C.I. Pigment, Yellow 13, No. 21100- C.I. Pigment, Yellow 14, No. 21095- C.I. Pigment, Orange 13, No. 21110- C.I. Pigment, Red 4, No. 12085- C.I. Pigment, Red 57, No. 15850- C.I. Pigment, Red 48:2, No. 15865- C.I. Pigment, Red 48:4, No. 15865kgfreefreefreefree
3204.17.908--- Otherkgfreefreefreefree
3204.19-- Other, including mixtures of colouring matter of two or more of the subheadings 3204.11 to 3204.19:
3204.19.102--- Mixtures based on azo pigments of the following description and International Colour Index Numbers:- C.I. Pigment, Yellow 1, No. 11680- C.I. Pigment, Yellow 3, No. 11710- C.I. Pigment, Yellow 12, No. 21090- C.I. Pigment, Yellow 13, No. 21100- C.I. Pigment, Yellow 14, No. 21095- C.I. Pigment, Orange 13, No. 21110- C.I. Pigment, Red 4, No. 12085- C.I. Pigment, Red 57, No. 15850- C.I. Pigment, Red 48:2, No. 15865- C.I. Pigment, Red 48:4, No. 15865kgfreefreefreefree
3204.19.900--- Otherkgfreefreefreefree
3204.202- Synthetic organic products of a kind used as fluorescent brightening agentskgfreefreefreefree
3204.904- Otherkgfreefreefreefree
3205.007Colour lakes; preparations as specified in Note 3 to this Chapter based on colour lakeskgfreefreefreefree
32.06Other colouring matter; preparations as specified in Note 3 to this Chapter (excluding those of heading 32.03, 32.04 or 32.05); inorganic products of a kind used as luminophores, whether or not chemically defined:
3206.1- Pigments and preparations based on titanium dioxide:
3206.111-- Containing 80 per cent or more by mass of titanium dioxide calculated on the dry matterkg10%freefreefree
3206.19-- Other:
3206.19.109--- Titanium dioxide coated micakgfreefreefreefree
3206.19.908--- Otherkg10%freefreefree
3206.20- Pigments and preparations based on chromium compounds:
3206.20.107-- Pigments and preparations based on chrome oxide green, lead chromate, zinc chromate, barium chromate or strontium chromate, inorganic pigments of the following description and International Colour Index Numbers:- C.I. Pigment, Yellow 34, No. 77603- C.I. Pigment, Yellow 34, No. 77600- C.I. Pigment, Red 104, No. 77605- C.I. Pigment, Red 104 and 84:4, No. 77605 and No. 15865- C.I. Pigment, Green 15, No. 77603 and No. 77520- C.I. Pigment, Green 13, No. 77603 and No. 74200- C.I. Pigment, Green 17, No. 77288- C.I. Pigment, Yellow 32, No. 77839- C.I. Pigment, Yellow 36, No. 77955kg10%freefreefree
3206.20.905-- Otherkgfreefreefreefree
3206.4- Other colouring matter and other preparations:
3206.415-- Ultramarine and preparations based thereonkgfreefreefreefree
3206.421-- Lithopone and other pigments and preparations based on zinc sulphidekgfreefreefreefree
3206.49-- Other:
3206.49.103--- Black masterbatchkg10%freefreefree
3206.49.200--- Inorganic pigments of the following description and International Colour Index Number: -C.I. Pigment, Blue 27, No. 77510kg10%freefreefree
3206.49.901--- Otherkgfreefreefreefree
3206.503- Inorganic products of a kind used as luminophoreskgfreefreefreefree
32.07Prepared pigments, prepared opacifiers and prepared colours, vitrifiable enamels and glazes, engobes (slips), liquid lustres and similar preparations, of a kind used in the ceramic, enamelling or glass industry; glass frit and other glass, in the form of powder, granules or flakes:
3207.109- Prepared pigments, prepared opacifiers, prepared colours and similar preparationskgfreefreefreefree
3207.20- Vitrifiable enamels and glazes, engobes (slips) and similar preparations:
3207.20.100-- Vitrifiable enamels and similar preparationskg5%freefreefree
3207.20.208-- Vitrifiable glazes, engobes (slips) and similar preparationskgfreefreefreefree
3207.308- Liquid lustres and similar preparationskgfreefreefreefree
3207.402- Glass frit and other glass, in the form of powder, granules or flakeskgfreefreefreefree
32.08Paints and varnishes (including enamels and lacquers) based on synthetic polymers or chemically modified natural polymers, dispersed or dissolved in a non-aqueous medium; solutions as defined in Note 4 to this Chapter:
3208.102- Based on polyesterskg10%freefreefree
3208.20- Based on acrylic or vinyl polymers:
3208.20.104-- In aerosol containerskg10%freefreefree
3208.20.902-- Otherkg10%freefreefree
3208.90- Other:
3208.90.300-- Solutions as defined in Note 4 to this Chapter, of siliconeskgfreefreefreefree
3208.90.904-- Otherkg10%freefreefree
32.09Paints and varnishes (including enamels and lacquers) based on synthetic polymers or chemically modified natural polymers, dispersed or dissolved in an aqueous medium:
3209.10- Based on acrylic or vinyl polymers:
3209.10.103-- In aerosol containerskg10%freefreefree
3209.10.901-- Otherkg10%freefreefree
3209.90- Other:
3209.90.106-- In aerosol containerskg10%freefreefree
3209.90.908-- Otherkg10%freefreefree
3210.00Other paints and varnishes (including enamels, lacquers and distempers); prepared water pigments of a kind used for finishing leather:
3210.00.109- In aerosol containerskg10%freefreefree
3210.00.907- Otherkg10%freefreefree
3211.005Prepared drierskgfreefreefreefree
32.12Pigments (including metallic powders and flakes) dispersed in non-aqueous media, in liquid or paste form, of a kind used in the manufacture of paints (including enamels); stamping foils; dyes and other colouring matter put up in forms or packings for retail sale:
3212.103- Stamping foilskgfreefreefreefree
3212.90- Other:
3212.90.107-- Aluminium powders or flakes dispersed in non-aqueous mediakg10%freefreefree
3212.90.905-- Otherkgfreefreefreefree
32.13Artists', students' or signboard painters' colours, modifying tints, amusement colours and the like, in tablets, tubes, jars, bottles, pans or in similar forms or packings:
3213.10- Colours in sets:
3213.10.104-- In aerosol containerskgfreefreefreefree
3213.10.902-- Otherkgfreefreefreefree
3213.90- Other:
3213.90.100-- In aerosol containerskgfreefreefreefree
3213.90.909-- Otherkgfreefreefreefree
32.14Glaziers' putty, grafting putty, resin cements, caulking compounds and other mastics; painters' fillings; non-refractory surfacing preparations for facades, indoor walls, floors, ceilings or the like:
3214.100- Glaziers' putty, grafting putty, resin cements, caulking compounds and other mastics; painters' fillingskgfreefreefreefree
3214.907- Otherkgfreefreefreefree
32.15Printing ink, writing or drawing ink and other inks, whether or not concentrated or solid:
3215.1- Printing ink:
3215.110-- Blackkgfreefreefreefree
3215.191-- Otherkgfreefreefreefree
3215.900- Otherkgfreefreefreefree
Chapter 33
Essential Oils and Resinoids; Perfumery, Cosmetic or Toilet Preparations

Notes

1.

This Chapter does not cover the following:

(a)

natural oleoresins or vegetable extracts of heading 13.01 or 13.02;

(b)

soap or other products of heading 34.01; or

(c)

gum, wood or sulphate turpentine or other products of heading 38.05.

2.

The expression "odoriferous substances" in heading 33.02 refers only to the substances of heading 33.01, to odeoriferous constituents isolated from those substances or to synthetic aromatics.

3.

Headings 33.03 to 33.07 apply, inter alia,to products, whether or not mixed (excluding aqueous distillates and aqueous solutions of essential oils), suitable for use as goods of these headings and put up in packings of a kind sold by retail for such use.

4.

The expression "perfumery, cosmetic or toilet preparations" in heading 33.07 applies, inter alia, to the following products: scented sachets; odoriferous preparations which operate by burning; perfumed papers and papers impregnated or coated with cosmetics; contact lens or artificial eye solutions; wadding, felt and nonwovens, impregnated, coated or covered with perfume or cosmetics; animal toilet preparations.

HeadingCDDescriptionUnitGeneralEUEFTASADC
33.01Essential oils (terpeneless or not), including concretes and absolutes; resinoids; extracted oleoresins; concentrates of essential oils in fats, in fixed oils, in waxes or the like, obtained by enfleurage or maceration; terpenic by-products of the deterpenation of essential oils; aqueous distillates and aqueous solutions of essential oils:
3301.1- Essential oils of citrus fruit:
3301.121-- Of orangekgfreefreefreefree
3301.138-- Of lemonkgfreefreefreefree
3301.19-- Other:
3301.19.103--- Of limekgfreefreefreefree
3301.19.901--- Otherkgfreefreefreefree
3301.2- Essential oils other than those of citrus fruit:
3301.249-- Of peppermint (Mentha Piperita)kgfreefreefreefree
3301.255-- Of other mintskgfreefreefreefree
3301.29-- Other:
3301.29.108--- Of geraniumkgfreefreefreefree
3301.29.205--- Of jasminkgfreefreefreefree
3301.29.302--- Of lavender or of lavandinkgfreefreefreefree
3301.29.906--- Otherkgfreefreefreefree
3301.308- Resinoidskgfreefreefreefree
3301.90- Other:
3301.90.102-- Aqueous distillates and aqueous solutions of essential oilskg20%freefreefree
3301.90.200-- Extracted oleoresins obtained from extraction of opiumkg12%freefreefree
3301.90.307-- Extracted oleoresins obtained from extraction of liquoricekg12%freefreefree
3301.90.404-- Extracted oleoresins obtained from extraction of hopskgfreefreefreefree
3301.90.501-- Extracted oleoresins obtained from extraction of pyrethrum or of the roots of plants containing rotenonekgfreefreefreefree
3301.90.609-- Other extracted oleoresins obtained from extraction of natural cellular raw plant materials, suitable for pharmaceutical purposeskg15%freefreefree
3301.90.803-- Extracted oleoresins, of a kind used in the food industry, obtained from the extraction of fruits of the genus capsicumkg15%freefreefree
3301.90.900-- Otherkgfreefreefreefree
33.02Mixtures of odoriferous substances and mixtures (including alcoholic solutions) with a basis of one or more of these substances, of a kind used as raw materials in industry; other preparations based on odoriferous substances, of a kind used for the manufacture of beverages:
3302.102- Of a kind used in the food or drink industrieskgfreefreefreefree
3302.90- Other:
3302.90.106-- Containing, by volume, 50 per cent or more ethyl or propyl alcohol (excluding perfume bases)kg10%freefreefree
3302.90.904-- Otherkgfreefreefreefree
3303.00Perfumes and toilet waters:
3303.00.109- Pastes and other intermediate products not put up for sale by retailkg20%freefreefree
3303.00.907- Otherkg20%freefreefree
33.04Beauty or make-up preparations and preparations for the care of the skin (excluding medicaments), including sunscreen or sun tan preparations; manicure or pedicure preparations:
3304.10- Lip make-up preparations:
3304.10.107-- Pastes and other intermediate products not put up for sale by retailkg20%freefreefree
3304.10.204-- Preparations having a Sun Protection Factor (SPF) of 15 or morekg20%freefreefree
3304.10.905-- Otherkg20%freefreefree
3304.20- Eye make-up preparations:
3304.20.101-- Pastes and other intermediate products not put up for sale by retailkg20%freefreefree
3304.20.900-- Otherkg20%freefreefree
3304.30- Manicure or pedicure preparations:
3304.30.106-- Pastes and other intermediate products not put up for sale by retailkg20%freefreefree
3304.30.904-- Otherkg20%freefreefree
3304.9- Other:
3304.91-- Powders, whether or not compressed:
3304.91.108--- Pastes and other intermediate products not put up for sale by retailkg20%freefreefree
3304.91.207--- Baby powderskg20%freefreefree
3304.91.304--- Preparations having a Sun Protection Factor (SPF) of 15 or morekg20%freefreefree
3304.91.908--- Otherkg20%freefreefree
3304.99-- Other:
3304.99.100--- Pastes and other intermediate products not put up for sale by retailkg20%freefreefree
3304.99.208--- Barrier cream in packagings of 5 kg or morekg20%freefreefree
3304.99.305--- Preparations having a Sun Protection Factor (SPF) of 15 or morekg20%freefreefree
3304.99.909--- Otherkg20%freefreefree
33.05Preparations for use on the hair:
3305.103- Shampooskg20%freefreefree
3305.20- Preparations for permanent waving or straightening:
3305.20.105-- In aerosol containerskg20%freefreefree
3305.20.903-- Otherkg20%freefreefree
3305.30- Hair lacquers:
3305.30.101-- In aerosol containerskg20%freefreefree
3305.30.908-- Otherkg20%freefreefree
3305.908- Otherkg20%freefreefree
33.06Preparations for oral or dental hygiene, including denture fixative pastes and powders; yarn used to clean between the teeth (dental floss), in individual retail packages:
3306.107- Dentifriceskg10%freefreefree
3306.20- Yarn used to clean between the teeth (dental floss):
3306.20.109-- Of high tenacity aramid yarnkgfreefreefreefree
3306.20.907-- Otherkg15%freefreefree
3306.903- Otherkg10%freefreefree
33.07Pre-shave, shaving or after-shave preparations, personal deodorants, bath preparations, depilatories and other perfumery, cosmetic or toilet preparations, not elsewhere specified or included; prepared room deodorisers, whether or not perfumed or having disinfectant properties:
3307.10- Pre-shave, shaving or after-shave preparations:
3307.10.108-- Styptic pencilskg15%freefreefree
3307.10.205-- In aerosol containerskg20%freefreefree
3307.10.906-- Otherkg20%freefreefree
3307.20- Personal deodorants and anti-perspirants:
3307.20.102-- In aerosol containerskg20%freefreefree
3307.20.900-- Otherkg20%freefreefree
3307.300- Perfumed bath salts and other bath preparationskg20%freefreefree
3307.4- Preparations for perfuming or deodorizing rooms, including odoriferous preparations used during religious rites:
3307.410-- "Agarbatti" and other odoriferous preparations which operate by burningkgfreefreefreefree
3307.49-- Other:
3307.49.109--- In aerosol containerskg10%freefreefree
3307.49.907--- Otherkg10%freefreefree
3307.90- Other:
3307.90.104-- Contact lens or artificial eye solutions, including soluble tabletskgfreefreefreefree
3307.90.902-- Otherkg20%freefreefree
Chapter 34
Soap, Organic Surface-active Agents, Washing Preparations, Lubricating Preparations, Artificial Waxes, Prepared Waxes, Polishing or Scouring Preparations, Candles and Similar Articles, Modelling Pastes, "Dental Waxes" and Dental Preparations with a Basis of Plaster

Notes

1.

This Chapter does not cover the following:

(a)

edible mixtures or preparations of animal or vegetable fats or oils of a kind used as mould release preparations (heading 15.17);

(b)

separate chemically defined compounds; or

(c)

shampoos, dentifrices, shaving creams and foams, or bath preparations, containing soap or other organic surface-active agents (heading 33.05, 33.06 or 33.07).

2.

For the purposes of heading 34.01, the expression "soap" applies only to soap soluble in water. Soap and the other products of heading 34.01 may contain added substances (for example, disinfectants, abrasive powders, fillers or medicaments). Products containing abrasive powders remain classified in heading 34.01 only if in the form of bars, cakes or moulded pieces or shapes. In other forms they are to be classified in heading 34.05 as "scouring powders and similar preparations".

3.

For the purposes of heading 34.02, "organic surface-active agents" are products which when mixed with water at a concentration of 0,5 per cent at 20°C and left to stand for one hour at the same temperature:

(a)

give a transparent or translucent liquid or stable emulsion without separation of insoluble matter; and

(b)

reduce the surface tension of water to 4,5 x 10-² N/m (45 dyne/cm) or less.

4.

In heading 34.03 the expression "petroleum oils and oils obtained from bituminous minerals" applies to the products defined in Note 2 to Chapter 27.

5.

In heading 34.04, subject to the exclusions provided below, the expression "artificial waxes and prepared waxes" applies only to:

(a)

chemically produced organic products of a waxy character, whether or not water-soluble;

(b)

products obtained by mixing different waxes;

(c)

products of a waxy character with a basis of one or more waxes and containing fats, resins, mineral substances or other materials. The heading does not apply to:

(a)

products of heading 15.16, 34.02 or 38.23, even if having a waxy character;

(b)

unmixed animal waxes and unmixed vegetable waxes, whether or not refined or coloured, of heading 15.21;

(c)

mineral waxes and similar products of heading 27.12, whether or not intermixed or merely coloured; or

(d)

waxes mixed with, dispersed in or dissolved in a liquid medium (headings 34.05, 38.09, etc.).

HeadingCDDescriptionUnitGeneralEUEFTASADC
34.01Soap; organic surface-active products and preparations for use as soap, in the form of bars, cakes, moulded pieces or shapes, whether or not containing soap; organic surface-active products and preparations for washing the skin, in the form of liquid or cream put up for retail sale, whether or not containing soap; paper, wadding, felt and nonwovens, impregnated, coated or covered with soap or detergent:
3401.1- Soap and organic surface-active products and preparations, in the form of bars, cakes, moulded pieces or shapes, and paper, wadding, felt and nonwovens, impregnated, coated or covered with soap or detergent:
3401.117-- For toilet use (including medicated products)kg20%freefreefree
3401.198-- Otherkg20%freefreefree
3401.205- Soap in other formskg20%freefreefree
3401.303- Organic surface-active products and preparations for washing the skin, in the form of liquid or cream and put up for retail sale, whether or not containing soapkg20%freefreefree
34.02Organic surface-active agents (excluding soap); surface-active preparations, washing preparations (including auxiliary washing preparations) and cleaning preparations, whether or not containing soap (excluding those of heading 34.01):
3402.1- Organic surface-active agents, whether or not put up for retail sale:
3402.11-- Anionic:
3402.11.108--- In immediate packings of a content not exceeding 10 kgkgfreefreefreefree
3402.11.205--- In immediate packings of a content exceeding 10 kgkg15%freefreefree
3402.127-- Cationickg20%freefreefree
3402.133-- Non-ionickgfreefreefreefree
3402.191-- Otherkg20%freefreefree
3402.209- Preparations put up for retail salekg20%freefreefree
3402.900- Otherkg20%freefreefree
34.03Lubricating preparations (including cutting-oil preparations, bolt or nut release preparations, anti-rust or anti-corrosion preparations and mould release preparations, based on lubricants) and preparations of a kind used for the oil or grease treatment of textile materials, leather, furskins or other materials, but excluding preparations containing, as basic constituents, 70 per cent or more by mass of petroleum oils or of oils obtained from bituminous minerals:
3403.1- Containing petroleum oils or oils obtained from bituminous minerals:
3403.114-- Preparations for the treatment of textile materials, leather, furskins or other materialskgfreefreefreefree
3403.19-- Other:
3403.19.102--- In aerosol containerskgfreefreefreefree
3403.19.900--- Otherkgfreefreefreefree
3403.9- Other:
3403.910-- Preparations for the treatment of textile materials, leather, furskins or other materialskgfreefreefreefree
3403.99-- Other:
3403.99.109--- In aerosol containerskgfreefreefreefree
3403.99.907--- Otherkgfreefreefreefree
34.04Artificial waxes and prepared waxes:
3404.206- Of poly(oxyethylene) (polyethylene glycol)kg15%freefreefree
3404.90- Other:
3404.90.105-- Of oxidised polyethyleneskgfreefreefreefree
3404.90.903-- Otherkg15%freefreefree
34.05Polishes and creams, for footwear, furniture, floors, coachwork, glass or metal, scouring pastes and powders and similar preparations (whether or not in the form of paper, wadding, felt, nonwovens, cellular plastics or cellular rubber, impregnated, coated or covered with such preparations), (excluding waxes of heading 34.04):
3405.10- Polishes, creams and similar preparations for footwear or leather:
3405.10.102-- In aerosol containerskg15%freefreefree
3405.10.900-- Otherkg15%freefreefree
3405.20- Polishes, creams and similar preparations for the maintenance of wooden furniture, floors or other woodwork:
3405.20.107-- In aerosol containerskg15%freefreefree
3405.20.905-- Otherkg15%freefreefree
3405.304- Polishes and similar preparations for coachwork (excluding metal polishes)kg15%freefreefree
3405.409- Scouring pastes and powders and other scouring preparationskg15%freefreefree
3405.90- Other:
3405.90.109-- Grinding preparations of diamond dust, powder or gritkgfreefreefreefree
3405.90.907-- Otherkg15%freefreefree
3406.004Candles, tapers and the likekg20%freefreefree
3407.008Modelling pastes, including those put up for children's amusement; preparations known as "dental wax" or as "dental impression compounds", put up in sets, in packings for retail sale or in plates, horseshoe shapes, sticks or similar forms; other preparations for use in dentistry, with a basis of plaster (of calcined gypsum or calcium sulphate)kg10%freefreefree
Chapter 35
Albuminoidal Substances; Modified Starches; Glues; Enzymes

Notes

1.

This Chapter does not cover the following:

(a)

yeasts (heading 21.02);

(b)

blood fractions (excluding blood albumin not prepared for therapeutic or prophylactic uses), medicaments and other products of Chapter 30;

(c)

enzymatic preparations for pre-tanning (heading 32.02);

(d)

enzymatic soaking or washing preparations and other products of Chapter 34;

(e)

hardened proteins (heading 39.13); or

(f)

gelatin products of the printing industry (Chapter 49).

2.

For the purposes of heading 35.05, the term "dextrins" means starch degradation products with a reducing sugar content, expressed as dextrose on the dry substance, not exceeding 10 per cent. Such products with a reducing sugar content exceeding 10 per cent fall in heading 17.02.

HeadingCDDescriptionUnitGeneralEUEFTASADC
35.01Casein, caseinates and other casein derivatives; casein glues:
3501.102- Caseinkgfreefreefreefree
3501.909- Otherkgfreefreefreefree
35.02Albumins (including concentrates of two or more whey proteins, containing by mass more than 80 per cent whey proteins, calculated on the dry matter), albuminates and other albumin derivatives:
3502.1- Egg albumin:
3502.112-- Driedkg5%free5%free
3502.19-- Other:
3502.19.100--- Liquidkg20%free20%free
3502.19.909--- Otherkg5%free5%free
3502.200- Milk albumin, including concentrates of two or more whey proteinskgfreefreefreefree
3502.902- Otherkgfreefreefreefree
3503.00Gelatin (including gelatin in rectangular (including square) sheets, whether or not surface-worked or coloured) and gelatin derivatives; isinglass; other glues of animal origin (excluding casein glues of heading 35.01):
3503.00.102- Gelatin, in immediate packings of a content not exceeding 10 kgkg17%freefreefree
3503.00.153- Gelatin, in immediate packings of a content exceeding 10 kgkgfreefreefreefree
3503.00.307- Gelatin derivativeskg8,5%freefreefree
3503.00.358- Isinglass and other glues of animal originkgfreefreefreefree
3503.00.900- Otherkgfreefreefreefree
3504.009Peptones and their derivatives; other protein substances and their derivatives, not elsewhere specified or included; hide powder, whether or not chromedkgfreefreefreefree
35.05Dextrins and other modified starches (for example, pregelatinised or esterified starches); glues based on starches, or on dextrins or other modified starches:
3505.107- Dextrins and other modified starcheskgfreefreefreefree
3505.201- Glueskgfreefreefreefree
35.06Prepared glues and other prepared adhesives, not elsewhere specified or included; products suitable for use as glues or adhesives, put up for retail sale as glues or adhesives, not exceeding a net mass of 1 kg:
3506.100- Products suitable for use as glues or adhesives, put up for retail sale as glues or adhesives, not exceeding a net mass of 1 kgkgfreefreefreefree
3506.9- Other:
3506.913-- Adhesives based on polymers of headings 39.01 to 39.13 or on rubberkgfreefreefreefree
3506.994-- Otherkgfreefreefreefree
35.07Enzymes; prepared enzymes not elsewhere specified or included:
3507.104- Rennet and concentrates thereofkgfreefreefreefree
3507.900- Otherkgfreefreefreefree
Chapter 36
Explosives; Pyrotechnic Products; Matches; Pyrophoric Alloys; Certain Combustible Preparations

Notes

1.

This Chapter does not cover separate chemically defined compounds other than those described in Note 2(a) or (b) below.

2.

The expression "articles of combustible materials" in heading 36.06 applies only to:

(a)

metaldehyde, hexamethylenetetramine and similar substances, put up in forms (for example, tablets, sticks or similar forms) for use as fuels; fuels with a basis of alcohol, and similar prepared fuels, in solid or semi-solid form;

(b)

liquid or liquefied-gas fuels in containers of a kind used for filling or refilling cigarette or similar lighters and of a capacity not exceeding 300 ml; and

(c)

resin torches, firelighters and the like.

HeadingCDDescriptionUnitGeneralEUEFTASADC
3601.003Propellent powderskg10%freefreefree
3602.003Prepared explosives (excluding propellent powders)kgfreefreefreefree
3603.00Safety fuses; detonating fuses; percussion or detonating caps; igniters; electric detonators:
3603.00.104- Safety fuseskgfreefreefreefree
3603.00.201- Detonating fuseskgfreefreefreefree
3603.00.309- Percussion capskgfreefreefreefree
3603.00.406- Detonating capskgfreefreefreefree
3603.00.503- Igniterskgfreefreefreefree
3603.00.600- Electric detonatorskgfreefreefreefree
3603.00.902- Otherkgfreefreefreefree
36.04Fireworks, signalling flares, rain rockets, fog signals and other pyrotechnic articles:
3604.105- Fireworkskgfreefreefreefree
3604.901- Otherkgfreefreefreefree
3605.004Matches (excluding pyrotechnic articles of heading 36.04)kg15%freefreefree
36.06Ferro-cerium and other pyrophoric alloys in all forms; articles of combustible materials as specified in Note 2 to this Chapter:
3606.102- Liquid or liquefied-gas fuels in containers of a kind used for filling or refilling cigarette or similar lighters and of a capacity not exceeding 300 mlkgfreefreefreefree
3606.909- Otherkgfreefreefreefree
Chapter 37
Photographic or Cinematographic Goods

Notes

1.

This Chapter does not cover waste or scrap.

2.

In this Chapter the word "photographic" relates to a process by which visible images are formed, directly or indirectly, by the action of light or other forms of radiation on photosensitive surfaces.

HeadingCDDescriptionUnitGeneralEUEFTASADC
37.01Photographic plates and film in the flat, sensitised, unexposed, of any material (excluding paper, paperboard or textiles); instant print film in the flat, sensitised, unexposed, whether or not in packs:
3701.10- For X-ray:
3701.10.103-- Fluorographic plates and film in the flatm2freefreefreefree
3701.10.901-- Otherm215%freefreefree
3701.200- Instant print filmkgfreefreefreefree
3701.30- Other plates and film, with any side exceeding 255 mm:
3701.30.250-- Offset duplicating masters and lithographic plates, of aluminiumm2freefreefreefree
3701.30.609-- Other, orthochromaticm215%freefreefree
3701.30.900-- Otherm2freefreefreefree
3701.9- Other:
3701.919-- For colour photography (polychrome)kgfreefreefreefree
3701.99-- Other:
3701.99.452--- Offset duplicating masters and lithographic plates, of aluminiumm215%freefreefree
3701.99.700--- Other, orthochromaticm215%freefreefree
3701.99.905--- Otherm2freefreefreefree
37.02Photographic film in rolls, sensitised, unexposed, of any material (excluding paper, paperboard or textiles); instant print film in rolls, sensitised, unexposed:
3702.101- For X-raym2freefreefreefree
3702.3- Other film, without perforations, of a width not exceeding 105 mm:
3702.315-- For colour photography (polychrome)ufreefreefreefree
3702.32-- Other, with silver halide emulsion:
3702.32.109--- Orthochromatic filmm215%freefreefree
3702.32.907--- Otherm2freefreefreefree
3702.39-- Other:
3702.39.103--- Orthochromatic filmm215%freefreefree
3702.39.901--- Otherm2freefreefreefree
3702.4- Other film, without perforations, of a width exceeding 105 mm:
3702.419-- Of a width exceeding 610 mm and of a length exceeding 200 m, for colour photography (polychrome)m2freefreefreefree
3702.42-- Of a width exceeding 610 mm and of a length exceeding 200 m (excluding that for colour photography):
3702.42.103--- Instant print filmm2freefreefreefree
3702.42.901--- Otherm215%freefreefree
3702.43-- Of a width exceeding 610 mm and of a length not exceeding 200 m:
3702.43.108--- Orthochromatic filmm215%freefreefree
3702.43.908--- Otherm2freefreefreefree
3702.44-- Of a width exceeding 105 mm but not exceeding 610 mm:
3702.44.106--- Orthochromatic filmm215%freefreefree
3702.44.904--- Otherm2freefreefreefree
3702.5- Other film, for colour photography (polychrome):
3702.520-- Of a width not exceeding 16 mm and of a length exceeding 14 mmfreefreefreefree
3702.537-- Of a width exceeding 16 mm but not exceeding 35 mm and of a length not exceeding 30 m, for slidesmfreefreefreefree
3702.543-- Of a width exceeding 16 mm but not exceeding 35 mm and of a length not exceeding 30 m (excluding that for slides)mfreefreefreefree
3702.557-- Of a width exceeding 16 mm but not exceeding 35 mm and of a length exceeding 30 mmfreefreefreefree
3702.566-- Of a width exceeding 35 mmmfreefreefreefree
3702.9- Other:
3702.96-- Of a width not exceeding 35 mm and of a length not exceeding 30 m:
3702.96.101--- Orthochromatic filmm15%freefreefree
3702.96.902--- Othermfreefreefreefree
3702.97-- Of a width not exceeding 35 mm and of a length exceeding 30 m:
3702.97.108--- Orthochromatic filmm15%freefreefree
3702.97.906--- Othermfreefreefreefree
3702.98-- Of a width exceeding 35 mm:
3702.98.104--- Orthochromatic filmm15%freefreefree
3702.98.902--- Othermfreefreefreefree
37.03Photographic paper, paperboard and textiles, sensitised, unexposed:
3703.10- In rolls of a width exceeding 610 mm:
3703.10.100-- Paper, in rolls of a width exceeding 1 000 mm and of a length exceeding 100 mkgfreefreefreefree
3703.10.909-- Otherkg10%freefreefree
3703.208- Other, for colour photography (polychrome)kg10%freefreefree
3703.906- Otherkg10%freefreefree
3704.00Photographic plates, film, paper, paperboard and textiles, exposed but not developed:
3704.00.100- Cinematographic filmkgfreefreefreefree
3704.00.908- Otherkg10%freefreefree
3705.00Photographic plates and film, exposed and developed, other than cinematographic film:
3705.00.103For offset reproductionkg10%freefreefree
3705.00.9Other:
3705.00.917- Microfilmkgfreefreefreefree
3705.00.995- Otherkg10%freefreefree
37.06Cinematographic film, exposed and developed, whether or not incorporating sound track or consisting only of sound track:
3706.104- Of a width of 35 mm or moremfreefreefreefree
3706.900- Othermfreefreefreefree
37.07Chemical preparations for photographic uses (excluding varnishes, glues, adhesives and similar preparations); unmixed products for photographic uses, put up in measured portions or put up for retail sale in a form ready for use:
3707.108- Sensitising emulsionskgfreefreefreefree
3707.904- Otherkgfreefreefreefree
Chapter 38
Miscellaneous Chemical Products

Notes

1.

This Chapter does not cover the following:

(a)

Separate chemically defined elements or compounds with the exception of the following:

(1)

artificial graphite (heading 38.01);

(2)

insecticides, rodenticides, fungicides, herbicides, anti-sprouting products and plant-growth regulators, disinfectants and similar products, put up as described in heading 38.08;

(3)

products put up as charges for fire-extinguishers or put up in fire-extinguishing grenades (heading 38.13);

(4)

certified reference materials specified in Note 2 below;

(5)

products specified in Note 3(a) or 3(c) below;

(b)

mixtures of chemicals with foodstuffs or other substances with nutritive value, of a kind used in the preparation of human foodstuffs (generally heading 21.06);

(c)

slag, ash and residues (including sludges but excluding sewage sludge), containing metals, arsenic or their mixtures and meeting the requirements of Note 3(a) or 3(b) to Chapter 26 (heading 26.20);

(d)

medicaments (heading 30.03 or 30.04); or

(e)

spent catalysts of a kind used for the extraction of base metals or for the manufacture of chemical compounds of base metals (heading 26.20), spent catalysts of a kind used principally for the recovery of precious metal (heading 71.12) or catalysts consisting of metals or metal alloys in the form of, for example, finely devided powder or woven gauze (Section XIV or XV).

2.

(A)

For the purposes of heading 38.22, the expression "certified reference materials" means reference materials which are accompanied by a certificate which indicates the values of the certified properties, the methods used to determine these values and the degree of certainty associated with each value and which are suitable for analytical, calibrating or referencing purposes.

(B)

With the exception of the products of Chapter 28 or 29, for the classification of certified reference materials, heading 38.22 shall take precedence over any other heading in this Schedule.

3.

Heading 38.24 includes the following goods which are not to be classified in any other heading of this Schedule:

(a)

cultured crystals (other than optical elements) weighing not less than 2,5 g each, of magnesium oxide or of the halides of the alkali or alkaline-earth metals;

(b)

fusel oil; Dippel's oil;

(c)

ink removers put up in packings for retail sale;

(d)

stencil correctors, other correcting fluids and correction tapes (excluding those of heading 96.12) put up in packings for retail sale; and

(e)

ceramic firing testers, fusible (for example, Seger cones).

4.

Throughout this Schedule, "municipal waste" means waste of a kind collected from households, hotels, restaurants, hospitals, shops, offices, etc., road and pavement sweepings, as well as construction and demolition waste. Municipal waste generally contains a large variety of materials such as plastics, rubber, wood paper, textiles, glass, metals, food materials, broken furniture and other damaged or discarded articles. The term "municipal waste", however, does not cover the following:

(a)

Individual materials or articles segregated from the waste, such as wastes of plastics, rubber, wood, paper, textiles, glass or metals and spent batteries which fall in their appropriate headings in this Schedule;

(b)

industrial waste;

(c)

waste pharmaceuticals, as defined in Note 4(k) to Chapter 30; or

(d)

clinical waste, as defined in Note 6(a) below.

5.

For the purposes of heading 38.25, "sewage sludge" means sludge arising from urban effluent treatment plant and includes pre-treatment waste, scourings and unstabilised sludge. Stabilised sludge when suitable for use as fertilizer is excluded (Chapter 31).

6.

For the purposes of heading 38.25, the expression "other wastes" applies to:

(a)

clinical waste, that is, contaminated waste arising from medical research, diagnosis, treatment or other medical, surgical, dental or veterinary procedures, which often contain pathogens and pharmaceutical substances and require special disposal procedures (for example, soiled dressings, used gloves and used syringes);

(b)

waste organic solvents;

(c)

waste of metal pickling liquors, hydraulic fluids, brake fluids and anti-freezing fluids; and

(d)

other wastes from chemical or allied industries. The expression "other wastes" does not, however, cover wastes which contain mainly petroleum oils or oils obtained from bituminous minerals (heading 27.10).

7.

For the purposes of heading 38.26, the term "biodiesel" means mono-alkyl esters of fatty acids of a kind used as a fuel, derived from animal or vegetable fats and oils whether or not used.

Subheading Notes

1.

Subheadings 3808.52 and 3808.59 cover only goods of heading 38.08, containing one or more of the following substances: alachlor (ISO); aldicarb (ISO); aldrin (ISO); azinphos-methyl (ISO); binapacryl (ISO); camphechlor (ISO) (toxaphene); captafol (ISO); chlordane (ISO); chlordimeform (ISO); chlorobenzilate (ISO); DDT (ISO) (clofenotane (INN)), 1,1,1-trichloro-2,2-bis(p-chlorophenyl)ethane); dieldrin (ISO, INN); 4,6-dinitro-o-cresol (DNOC (ISO)) or its salts; dinoseb (ISO), its salts or its esters; endosulfan (ISO); ethylene dibromide (ISO) (1,2-dibromoethane); ethylene dichloride (ISO) (1,2-dichloroethane); fluoroacetamide (ISO); heptachlor (ISO); hexachlorobenzene (ISO); 1,2,3,4,5,6-hexachlorocyclohexane (HCH (ISO)), including lindane (ISO, INN); mercury compounds; methamidophos (ISO); monocrotophos (ISO); oxirane (ethylene oxide); parathion (ISO); parathion-methyl (ISO) (methyl-parathion); penta- and octabromodiphenyl ethers; pentachlorophenol (ISO), its salts or its esters; perfluorooctane sulphonic acid and its salts; perfluorooctane sulphonamides; perfluorooctane sulphonyl fluoride; phosphamidon (ISO); 2,4,5-T (ISO) (2,4,5-trichlorophenoxyacetic acid), its salts or its esters; tributyltin compounds. Subheading 3808.59 also covers dustable powder formulations containing a mixture of benomyl (ISO), carbofuran (ISO) and thiram (ISO).

2.

Subheadings 3808.61 to 3808.69 cover only goods of heading 38.08, containing alpha-cypermethrin (ISO), bendiocarb (ISO), bifenthrin (ISO), chlorfenapyr (ISO), cyfluthrin (ISO), deltamethrin (INN, ISO), etofenprox (INN), fenitrothion (ISO), lambda-cyhalothrin (ISO), malathion (ISO), pirimiphos-methyl (ISO) or propoxur (ISO).

3.

Subheadings 3824.81 to 3824.88 cover only mixtures and preparations containing one or more of the following substances: oxirane (ethylene oxide), polybrominated biphenyls (PBBs), polychlorinated biphenyls (PCBs), polychlorinated terphenyls (PCTs), tris(2,3-dibromopropyl) phosphate, aldrin (ISO), camphechlor (ISO) (toxaphene), chlordane (ISO), chlordecone (ISO), DDT (ISO) (clofenotane (INN), 1,1,1-trichloro-2,2-bis(p-chlorophenyl)ethane), dieldrin (ISO, INN), endosulfan (ISO), endrin (ISO), heptachlor (ISO), mirex (ISO), 1,2,3,4,5,6-hexachlorocyclohexane (HCH (ISO)), including lindane (ISO, INN), pentachlorobenzene (ISO), hexachlorobenzene (ISO), perfluorooctane sulphonic acid, its salts, perfluorooctane sulphonamides, perfluorooctane sulphonyl fluoride or tetra-, penta-, hexa-, hepta- or octabromodiphenyl ethers.

4.

For the purposes of subheadings 3825.41 and 3825.49, "waste organic solvents" are wastes containing mainly organic solvents, not fit for further use as presented as primary products, whether or not intended for recovery of the solvents.

Additional Note

1

(a)

Tariff subheading 3826.00.10 covers biodiesel

(i)

intended for use, advertised for use, put up for use or otherwise marketed or disposed of for use as a liquid fuel substitute for petroleum based distillate fuels; or

(ii)

used for blending with petroleum fuels.

(b)

Biodiesel that does not conform to Note 1(a), is to be classified in tariff subheading 3826.00.90.

(c)

Biodiesel classifiable in subheading 3826.00.10 does not include biodiesel blended with petroleum based fuels classifiable in Chapter 27 or elsewhere in this Schedule.

HeadingCDDescriptionUnitGeneralEUEFTASADC
38.01Artificial graphite; colloidal or semi-colloidal graphite; preparations based on graphite or other carbon in the form of pastes, blocks, plates or other semi-manufactures:
3801.10- Artificial graphite:
3801.10.105-- Unmachined electrodeskgfreefreefreefree
3801.10.903-- Otherkgfreefreefreefree
3801.202- Colloidal or semi-colloidal graphitekgfreefreefreefree
3801.307- Carbonaceous pastes for electrodes and similar pastes for furnace liningskgfreefreefreefree
3801.904- Otherkgfreefreefreefree
38.02Activated carbon; activated natural mineral products; animal black, including spent animal black:
3802.101- Activated carbonkgfreefreefreefree
3802.908- Otherkgfreefreefreefree
3803.000Tall oil, whether or not refinedkgfreefreefreefree
3804.004Residual lyes from the manufacture of wood pulp, whether or not concentrated, desugared or chemically treated, including lignin sulphonates but excluding tall oil of heading 38.03kgfreefreefreefree
38.05Gum, wood or sulphate turpentine and other terpenic oils produced by the distillation or other treatment of coniferous woods; crude dipentene; sulphite turpentine and other crude para-cymene; pine oil containing alpha-terpineol as the main constituent:
3805.102- Gum, wood or sulphate turpentine oilskgfreefreefreefree
3805.909- Otherkgfreefreefreefree
38.06Rosin and resin acids, and derivatives thereof; rosin spirit and rosin oils; run gums:
3806.106- Rosin and resin acidskgfreefreefreefree
3806.200- Salts of rosin, of resin acids or of derivatives of rosin or resin acids (excluding salts of rosin adducts)kgfreefreefreefree
3806.305- Ester gumskgfreefreefreefree
3806.902- Otherkgfreefreefreefree
3807.005Wood tar; wood tar oils; wood creosote; wood naphtha; vegetable pitch; brewers' pitch and similar preparations based on rosin, resin acids or on vegetable pitchkgfreefreefreefree
38.08Insecticides, rodenticides, fungicides, herbicides, anti-sprouting products and plant-growth regulators, disinfectants and similar products, put up in forms or packings for retail sale or as preparations or articles (for example, sulphur-treated bands, wicks and candles, and fly-papers):
3808.5- Goods specified in Subheading Note 1 to this Chapter:
3808.52-- DDT (ISO) (clofenotane (INN)), in packings of a net mass content not exceeding 300 g:
3808.52.101--- In aerosol containerskgfreefreefreefree
3808.52.901--- Otherkgfreefreefreefree
3808.59-- Other:
3808.59.211--- Insecticides (excluding that containing camphechlor (ISO) (toxaphene)), in aerosol containerskgfreefreefreefree
3808.59.238--- Insecticides (excluding that containing camphechlor (ISO) (toxaphene)), not in aerosol containerskgfreefreefreefree
3808.59.254--- Products containing camphechlor (ISO) (toxaphene), in aerosol containerskgfreefreefreefree
3808.59.270--- Products containing camphechlor (ISO) (toxaphene), not in aerosol containerskgfreefreefreefree
3808.59.297--- Fungicides suitable for the treatment of wood, plants, trees or seeds (excluding those containing compounds of copper, chromium and arsenic or metallic compounds of dithiocarbamates or bis- dithiocarbamates as active ingredient but not excluding those fungicides containing manganese ethylenebis (dithiocarbamate) (polymeric) complex with zinc salts as active ingredient), in aerosol containerskgfreefreefreefree
3808.59.319--- Fungicides suitable for the treatment of wood, plants, trees or seeds (excluding those containing compounds of copper, chromium and arsenic or metallic compounds of; dithiocarbamates or bis- dithiocarbamates as active ingredient but not excluding those fungicides containing manganese ethylenebis (dithiocarbamate) (polymeric) complex with zinc salts as active ingredient), not in aerosol containerskgfreefreefreefree
3808.59.335--- Other fungicides, in aerosol containerskg10%freefreefree
3808.59.351--- Other fungicides, not in aerosol containerskg10%freefreefree
3808.59.378--- Herbicides, anti-sprouting products and plant growth regulators with one of the following active ingredients: atrazin; alachlor; 2-methyl-4- c h l o r o p h e n o x y a c e t i c a c i d o r i t s d e r i v a t i v e s ; 2 , 4 - dichlorophenoxyacetic acid or its derivatives; trifluralin, in aerosol containerskgfreefreefreefree
3808.59.394--- Herbicides, anti-sprouting products and plant growth regulators with one of the following active ingredients: atrazin; alachlor; 2-methyl-4- c h l o r o p h e n o x y a c e t i c a c i d o r i t s d e r i v a t i v e s ; 2 , 4 - dichlorophenoxyacetic acid or its derivatives; trifluralin, not in aerosol containerskgfreefreefreefree
3808.59.416--- Other herbicides, anti-sprouting products and plant growth regulators with diuron or simazine as active ingredient, in aerosol containerskgfreefreefreefree
3808.59.432--- Other herbicides, anti-sprouting products and plant growth regulators with diuron or simazine as active ingredient, not in aerosol containerskgfreefreefreefree
3808.59.459--- Other plant-growth regulators and anti-sprouting products, in aerosol containerskgfreefreefreefree
3808.59.475--- Other plant-growth regulators and anti-sprouting products, not in aerosol containerskgfreefreefreefree
3808.59.491--- Disinfectants, in aerosol containerskg10%freefreefree
3808.59.513--- Other, disinfectants in immediate packings of a content not exceeding 5 kg or in containers not holding more than 5 likg10%freefreefree
3808.59.539--- Trichlorocyanuric acid (TCIA) containing disinfectants, in aerosol containerskg10%freefreefree
3808.59.556--- Trichlorocyanuric acid (TCIA) containing disinfectants, not in aerosol containerskg10%freefreefree
3808.59.599--- Other disinfectants with a coal tar derivative as active ingredient, in aerosol containerskg10%freefreefree
3808.59.610--- Other disinfectants with a coal tar derivative as active ingredient, not in aerosol containerskg10%freefreefree
3808.59.9--- Other:
3808.59.912---- In aerosol containerskgfreefreefreefree
3808.59.998---- Otherkgfreefreefreefree
3808.6- Goods specified in Subheading Note 2 to this Chapter:
3808.61-- In packings of a net mass content not exceeding 300 g:
3808.61.103--- In aerosol containerskgfreefreefreefree
3808.61.908--- Otherkgfreefreefreefree
3808.62-- In packings of a net mass content exceeding 300 g but not exceeding 7.5 kg:
3808.62.106--- In aerosol containerskgfreefreefreefree
3808.62.904--- Otherkgfreefreefreefree
3808.69-- Other:
3808.69.100--- In aerosol containerskgfreefreefreefree
3808.69.909--- Otherkgfreefreefreefree
3808.9- Other:
3808.91-- Insecticides:
3808.91.1--- Containing bromomethane (methyl bromide) or bromochloromethane:
3808.91.111---- In aerosol containerskgfreefreefreefree
3808.91.197---- Otherkgfreefreefreefree
3808.91.9--- Other:
3808.91.919---- In aerosol containerskgfreefreefreefree
3808.91.995---- Otherkgfreefreefreefree
3808.92-- Fungicides:
3808.92.2--- Suitable for the treatment of wood, plants, trees or seed (excluding those containing compounds of copper, chromium and arsenic or metallic compounds of dithiocarbamates or bis-dithiocarbamates as active ingredient but not excluding those containing manganese ethylenebis (dithiocarbamate) (polymeric) complex with zinc salts as active ingredient):
3808.92.215---- In aerosol containerskgfreefreefreefree
3808.92.290---- Otherkgfreefreefreefree
3808.92.3--- Other, containing bromomethane (methyl bromide) or bromochloromethane:
3808.92.312---- In aerosol containerskgfreefreefreefree
3808.92.398---- Otherkgfreefreefreefree
3808.92.9--- Other:
3808.92.916---- In aerosol containerskg10%freefreefree
3808.92.991---- Otherkg10%freefreefree
3808.93-- Herbicides, anti-sprouting products and plant-growth regulators:
3808.93.041--- With atrazine as active ingredient, in aerosol containerskgfreefreefreefree
3808.93.076--- With atrazine as active ingredient, not in aerosol containerskgfreefreefreefree
3808.93.092--- With alachlor as active ingredient, in aerosol containerskgfreefreefreefree
3808.93.130--- With alachlor as active ingredient, not in aerosol containerskgfreefreefreefree
3808.93.165--- With diuron or simazine as active ingredient, in aerosol containerskgfreefreefreefree
3808.93.199--- With diuron or simazine as active ingredient, not in aerosol containerskgfreefreefreefree
3808.93.319--- With 2-methyl-4-chlorophenoxyacetic acid or its derivatives as active ingredient, in aerosol containerskgfreefreefreefree
3808.93.335--- With 2-methyl-4-chlorophenoxyacetic acid or its derivatives as active ingredient, not in aerosol containerskgfreefreefreefree
3808.93.343--- With 2,4-dichlorophenoxyacetic acid or its derivatives as active ingredient, in aerosol containerskgfreefreefreefree
3808.93.378--- With 2,4-dichlorophenoxyacetic acid or its derivatives as active ingredient, not in aerosol containerskgfreefreefreefree
3808.93.416--- With trifluralin as active ingredient, in aerosol containerskgfreefreefreefree
3808.93.432--- With trifluralin as active ingredient, not in aerosol containerskgfreefreefreefree
3808.93.777--- Other plant-growth regulators and anti-sprouting products, in aerosol containerskgfreefreefreefree
3808.93.793--- Other plant-growth regulators and anti-sprouting products, not in aerosol containerskgfreefreefreefree
3808.93.831--- Other , conta ining bromomethane (methy l bromide) or bromochloromethane, in aerosol conta inerskgfreefreefreefree
3808.93.858--- Other , conta ining bromomethane (methy l bromide) or bromochloromethane, not in aerosol conta inerskgfreefreefreefree
3808.93.9--- Other:
3808.93.912---- In aerosol containerskgfreefreefreefree
3808.93.998---- Otherkgfreefreefreefree
3808.94-- Disinfectants:
3808.94.1--- In immediate packings of a content not exceeding 5 kg or in containers holding not more than 5 li:
3808.94.110---- In aerosol containerskg10%freefreefree
3808.94.196---- Otherkg10%freefreefree
3808.94.3--- Trichlorocyanuric acid (TCIA) containing disinfectants:
3808.94.315---- In aerosol containerskg10%freefreefree
3808.94.390---- Otherkg10%freefreefree
3808.94.4--- Other, with a coal tar derivate as active ingredient:
3808.94.412---- In aerosol containerskgfreefreefreefree
3808.94.498---- Otherkgfreefreefreefree
3808.94.8--- Other, containing bromomethane (methyl bromide) or bromochloromethane:
3808.94.811---- In aerosol containerskgfreefreefreefree
3808.94.897---- Otherkgfreefreefreefree
3808.94.9--- Other:
3808.94.919---- In aerosol containerskgfreefreefreefree
3808.94.994---- Otherkgfreefreefreefree
3808.99-- Other:
3808.99.1--- Other, containing bromomethane (methyl bromide) or bromochloromethane:
3808.99.112---- In aerosol containerskgfreefreefreefree
3808.99.198---- Otherkgfreefreefreefree
3808.99.9--- Other:
3808.99.910---- In aerosol containerskgfreefreefreefree
3808.99.996---- Otherkgfreefreefreefree
38.09Finishing agents, dye carriers to accelerate the dyeing or fixing of dyestuffs and other products and preparations (for example, dressings and mordants), of a kind used in the textile, paper, leather or like industries, not elsewhere specified or included:
3809.107- With a basis of amylaceous substanceskgfreefreefreefree
3809.9- Other:
3809.911-- Of a kind used in the textile or like industrykgfreefreefreefree
3809.926-- Of a kind used in the paper or like industrieskgfreefreefreefree
3809.932-- Of a kind used in the leather or like industrieskgfreefreefreefree
38.10Pickling preparations for metal surfaces; fluxes and other auxiliary preparations for soldering, brazing or welding; soldering, brazing or welding powders and pastes consisting of metal and other materials; preparations of a kind used as cores or coatings for welding electrodes or rods:
3810.107- Pickling preparations for metal surfaces; soldering, brazing or welding powders and pastes consisting of metal and other materialskgfreefreefreefree
3810.903- Otherkgfreefreefreefree
38.11Anti-knock preparations, oxidation inhibitors, gum inhibitors, viscosity improvers, anti-corrosive preparations and other prepared additives, for mineral oils (including gasoline) or for other liquids used for the same purposes as mineral oils:
3811.1- Anti-knock preparations:
3811.117-- Based on lead compoundskgfreefreefreefree
3811.198-- Otherkgfreefreefreefree
3811.2- Additives for lubricating oils:
3811.211-- Containing petroleum oils or oils obtained from bituminous materialskgfreefreefreefree
3811.292-- Otherkgfreefreefreefree
3811.907- Otherkgfreefreefreefree
38.12Prepared rubber accelerators; compound plasticisers for rubber or plastics, not elsewhere specified or included; anti-oxidising preparations and other compound stabilisers for rubber or plastics:
3812.104- Prepared rubber acceleratorskgfreefreefreefree
3812.209- Compound plasticisers for rubber or plasticskgfreefreefreefree
3812.3- Anti-oxidising preparations and other compound stabilisers for rubber or plastics:
3812.31-- Mixtures of oligomers of 2,2,4-trimethyl-1,2-dihydroquinoline (TMQ):
3812.31.107--- Anti-oxidising preparations for rubberkgfreefreefreefree
3812.31.204--- Compound stabilisers containing cadmium caprylate, cadmium naphthanatebenzoate, cadmium octoate, barium caprylate, barium nonyl phenate, dibutyltin thioglycolate, dimethyltin thioglycolate, zinc octoate, potassium octoate or zinc stearatekgfreefreefreefree
3812.31.905--- Otherkg10%freefreefree
3812.39-- Other:
3812.39.108--- Anti-oxidising preparations for rubberkgfreefreefreefree
3812.39.205--- Compound stabilisers containing cadmium caprylate, cadmium naphthanatebenzoate, cadmium octoate, barium caprylate, barium nonyl phenate, dibutylin thioglycolate, dimethyltin thioglycolate, zinc octoate, potassium octoate or zinc stearatekgfreefreefreefree
3812.39.906--- Otherkg10%freefreefree
3813.00Preparations and charges for fire-extinguishers; charged fire-extinguishing grenades:
3813.00.259- Preparations in liquid form, containing fluorine compounds or containing protein, in aerosol containerskg10%freefreefree
3813.00.275- Preparations in liquid form, containing fluorine compounds or containing protein, not in aerosol containerskg10%freefreefree
3813.00.291- O t h e r , c o n t a i n i n g b r o m o c h l o r o d i f l u o r o m e t h a n e , bromotrifluoromethane or dibromo-tetrafluoroethanes, in aerosol containerskgfreefreefreefree
3813.00.313- O t h e r , c o n t a i n i n g b r o m o c h l o r o d i f l u o r o m e t h a n e , bromotrifluoromethane or dibromo-tetrafluoroethanes, not in aerosol containerskgfreefreefreefree
3813.00.338- O t h e r , c o n t a i n i n g m e t h a n e , e t h a n e o r p r o p a n e hydrobromofluorocarbons (HBFCs), in aerosol containerskgfreefreefreefree
3813.00.356- O t h e r , c o n t a i n i n g m e t h a n e , e t h a n e o r p r o p a n e hydrobromofluorocarbons (HBFCs), not in aerosol containerskgfreefreefreefree
3813.00.372- O t h e r , c o n t a i n i n g m e t h a n e , e t h a n e o r p r o p a n e hydrochlorofluorocarbons (HCFCs), in aerosol containerskgfreefreefreefree
3813.00.399- O t h e r , c o n t a i n i n g m e t h a n e , e t h a n e o r p r o p a n e hydrochlorofluorocarbons (HCFCs), not in aerosol containerskgfreefreefreefree
3813.00.410- Other, containing bromochloromethane, in aerosol containerskgfreefreefreefree
3813.00.437- Other, containing bromochloromethane, not in aerosol containerskgfreefreefreefree
3813.00.909- Otherkgfreefreefreefree
3814.00Organic composite solvents and thinners, not elsewhere specified or included; prepared paint or varnish removers:
3814.00.1- Containing methane, ethane or propane chlorofluorocarbons (CFC's), whether or not containing hydrochlorofluorocarbons (HCFC's):
3814.00.112-- In aerosol containerskg10%freefreefree
3814.00.198-- Otherkg10%freefreefree
3814.00.2- Containing methane, ethane or propane hydrochlorofluorocarbons (HCFCs), but not containing chlorofluorocarbons (CFCs):
3814.00.218-- In aerosol containerskgfreefreefreefree
3814.00.295-- Otherkgfreefreefreefree
3814.00.3- Containing carbon tetrachloride, bromochloromethane or 1,1,1-trichloroethane (methyl chloroform):
3814.00.317-- In aerosol containerskgfreefreefreefree
3814.00.392-- Otherkgfreefreefreefree
3814.00.9- Other:
3814.00.910-- In aerosol containerskg10%freefreefree
3814.00.996-- Otherkg10%freefreefree
38.15Reaction initiators, reaction accelerators and catalytic preparations, not elsewhere specified or included:
3815.1- Supported catalysts:
3815.111-- With nickel or nickel compounds as the active substancekgfreefreefreefree
3815.128-- With precious metal or precious metal compounds as the active substancekgfreefreefreefree
3815.192-- Otherkgfreefreefreefree
3815.901- Otherkgfreefreefreefree
3816.004Refractory cements, mortars, concretes and similar compositions (excluding products of heading 38.01)kgfreefreefreefree
3817.00Mixed alkylbenzenes and mixed alkylnaphthalenes (excluding those of heading 27.07 or 29.02):
3817.00.105- Mixed alkylbenzeneskgfreefreefreefree
3817.00.202- Mixed alkylnaphthaleneskgfreefreefreefree
3818.00Chemical elements doped for use in electronics, in the form of discs, wafers of similar forms; chemical compounds doped for use in electronics:
3818.00.109- Chemical elementskgfreefreefreefree
3818.00.206- Chemical compounds, packed for retail salekgfreefreefreefree
3818.00.907- Otherkg10%freefreefree
3819.00Hydraulic brake fluids and other prepared liquids for hydraulic transmission, not containing or containing less than 70 per cent by mass of petroleum oils or oils obtained from bituminous minerals:
3819.00.102- Hydraulic brake fluidskgfreefreefreefree
3819.00.205- Prepared liquids for hydraulic transmission, containing 44 per cent or more by mass of diethyl glycol and 38 per cent or more of ethylene or propylene copolymerskgfreefreefreefree
3819.00.900- Otherkg10%freefreefree
3820.005Anti-freezing preparations and prepared de-icing fluidskgfreefreefreefree
3821.009Prepared culture media for the development or maintenance of micro- organisms (including viruses and the like) or of plant, human or animal cellskgfreefreefreefree
3822.002Diagnostic or laboratory reagents on a backing, prepared diagnostic or laboratory reagents whether or not on a backing (excluding those of heading 30.02 or 30.06); certified reference materialskgfreefreefreefree
38.23Industrial monocarboxylic fatty acids; acid oils from refining; industrial fatty alcohols:
3823.1- Industrial monocarboxylic fatty acids; acid oils from refining:
3823.117-- Stearic acidkgfreefreefreefree
3823.123-- Oleic acidkgfreefreefreefree
3823.137-- Tall oil fatty acidskg10%freefreefree
3823.198-- Otherkg10%freefreefree
3823.708- Industrial fatty alcoholskg10%freefreefree
38.24Prepared binders for foundry moulds or cores; chemical products and preparations of the chemical or allied industries (including those consisting of mixtures of natural products), not elsewhere specified or included:
3824.104- Prepared binders for foundry moulds or coreskgfreefreefreefree
3824.303- Non-agglomerated metal carbides mixed together or with metallic binderskgfreefreefreefree
3824.408- Prepared additives for cements, mortars or concreteskgfreefreefreefree
3824.502- Non-refractory mortars and concreteskgfreefreefreefree
3824.607- Sorbitol (excluding that of subheading 2905.44)kgfreefreefreefree
3824.7- Mixtures containing halogenated derivatives of methane, ethane or propane:
3824.71-- Containing chlorofluorocarbons (CFCs), whether or not containing hydrochlorofluorocarbons (HCFCs), perfluorocarbons (PFCs) or hydrofluorocarbons (HFCs):
3824.71.059--- Containing acyclic hydrocarbons, perhalogenated only with fluorine and chlorine (excluding those containing chlorodifluoromethane, dichlorodifluoromethane or trichlorofluoromethane)kg10%freefreefree
3824.71.113--- Containing dichlorodifluoromethane and 1,1-difluoroethane (R-500)kg10%freefreefree
3824.71.133--- Containing chlorodifluoromethane and chloropentafluoroethane (R-502)kgfreefreefreefree
3824.71.806--- Other, containing dichlorodifluoromethane or trichlorofluoromethanekg10%freefreefree
3824.71.857--- Other, containing perhalogenated derivat ives of acycl ic hydrocarbons containing two or more different halogenskgfreefreefreefree
3824.71.903--- Otherkgfreefreefreefree
3824.72-- Containing bromochlorodifluoromethane, bromotrifluoromethane or dibromotetrafluoroethanes:
3824.72.055--- Containing acyclic hydrocarbons, perhalogenated only with fluorine and chlorine (excluding those containing chlorodifluoromethane, dichlorodifluoromethane or trichlorofluoromethane)kgfreefreefreefree
3824.72.802--- Other, containing dichlorodifluoromethane or trichlorofluoromethanekgfreefreefreefree
3824.72.853--- Other, containing perhalogenated derivat ives of acycl ic hydrocarbons containing two or more different halogenskg10%freefreefree
3824.72.901--- Otherkgfreefreefreefree
3824.73-- Containing hydrobromofluorocarbons (HBFCs):
3824.73.051--- Containing acyclic hydrocarbons, perhalogenated only with fluorine and chlorine (excluding those containing chlorodifluoromethane, dichlorodifluoromethane or trichlorofluoromethane)kgfreefreefreefree
3824.73.809--- Other, containing dichlorodifluoromethane or trichlorofluoromethanekgfreefreefreefree
3824.73.850--- Other, containing perhalogenated derivat ives of acycl ic hydrocarbons containing two or more different halogenskg10%freefreefree
3824.73.906--- Otherkgfreefreefreefree
3824.74-- Containing hydrochlorofluorocarbons (HCFCs), whether or not containing perfluorocarbons (PFCs) or hydrofluorocarbons (HFCs), but not containing chlorofluorocarbons (CFCs):
3824.74.058--- Containing acyclic hydrocarbons, perhalogenated only with fluorine and chlorine (excluding those containing chlorodifluoromethane, dichlorodifluoromethane or trichlorofluoromethane)kg10%freefreefree
3824.74.171--- Containing chlorodifluoromethane, iso-Butane and 1-chloro-1,1-difluoroethane (R-406A)kgfreefreefreefree
3824.74.198--- Containing chlorodifluoromethane, 1,1,1-trifluoroethane and pentafluoroethane (R-408 A)kgfreefreefreefree
3824.74.212--- Containing chlorodifluoromethane, chlorotetrafluoroethanes and 1-chloro-1,1-difluoroethane (R-409A) or (R-409B)kgfreefreefreefree
3824.74.236--- Containing chlorodifluoromethane and 1,1-difluoroethane (R-415B)kgfreefreefreefree
3824.74.252--- Containing propane, chlorodifluoromethane and 1,1-difluoroethane (R418A)kgfreefreefreefree
3824.74.279--- Containing chlorodifluoromethane and 1-chloro-1,1-difluoroethane (R-22/R-142B)kgfreefreefreefree
3824.74.805--- Other, containing dichlorodifluoromethane or trichlorofluoromethanekg10%freefreefree
3824.74.856--- Other, containing perhalogenated derivat ives of acycl ic hydrocarbons containing two or more different halogenskgfreefreefreefree
3824.74.902--- Otherkgfreefreefreefree
3824.753-- Containing carbon tetrachloridekgfreefreefreefree
3824.762-- Containing 1,1,1-trichloroethane (methyl chloroform)kgfreefreefreefree
3824.77-- Containing bromomethane (methyl bromide) or bromochloromethane:
3824.77.057--- Containing acyclic hydrocarbons, perhalogenated only with fluorine and chlorine (excluding those containing chlorodifluoromethane, dichlorodifluoromethane or trichlorofluoromethane)kgfreefreefreefree
3824.77.804--- Other, containing dichlorodifluoromethane or trichlorofluoromethanekgfreefreefreefree
3824.77.855--- Other, containing perhalogenated derivat ives of acycl ic hydrocarbons containing two or more different halogenskg10%freefreefree
3824.77.901--- Otherkgfreefreefreefree
3824.78-- Containing perfluorocarbons (PFCs) or hydrofluorocarbons (HFCs), but not containing chlorofluorocarbons (CFCs) or hydrochlorofluorocarbons (HCFCs):
3824.78.070--- Containing 1,1,1-trifluoroethane, pentafluoroethane and 1,1,1-2- tetrafluoroethane (R-404A)kgfreefreefreefree
3824.78.118--- Containing difluoromethane, pentafluoroethane and 1,1,1,2- tetrafluoroethane (R-407A), (R-407B), (R-407C), (R-407D) or (R- 407E)kgfreefreefreefree
3824.78.150--- Containing 1,1,1,2-tetrafluoroethane, difluoromethane and pentafluoroethane (R-407F) (LT)kgfreefreefreefree
3824.78.193--- Containing difluoromethane and pentafluoroethane (R-410A)kgfreefreefreefree
3824.78.231--- Containing pentafluoroethane and 1,1,1-trifluoroethane (R-507)kgfreefreefreefree
3824.78.274--- Containing trifluoromethane and perfluoroethane (R-508A) or (R- 508B)kgfreefreefreefree
3824.79-- Other:
3824.79.050--- Containing acyclic hydrocarbons, perhalogenated only with fluorine and chlorine (excluding those containing chlorodifluoromethane, dichlorodifluoromethane or trichlorofluoromethane)kgfreefreefreefree
3824.79.807--- Other, containing dichlorodifluoromethane or trichlorofluoromethanekgfreefreefreefree
3824.79.858--- Other, containing perhalogenated derivat ives of acycl ic hydrocarbons containing two or more different halogenskg10%freefreefree
3824.79.904--- Otherkgfreefreefreefree
3824.8- Goods specified in Subheading Note 3 to this Chapter:
3824.812-- Containing oxirane (ethylene oxide)kgfreefreefreefree
3824.82-- Containing polychlorinated biphenyls (PCBs), polychlorinated terphenyls (PCTs) or polybrominated biphenyls (PBBs):
3824.82.106--- Containing polychlorinated biphenyls (PCBs)kgfreefreefreefree
3824.82.904--- Otherkgfreefreefreefree
3824.835-- Containing tris(2,3-dibromopropyl) phosphatekgfreefreefreefree
3824.841-- Containing aldrin (ISO), camphechlor (ISO) (toxaphene), chlordane (ISO), chlordecone (ISO), DDT (ISO) (clofenotane (INN), 1,1,1- trichloro-2,2-bis(p-chlorophenyl)ethane), dieldrin (ISO, INN), endosulfan (ISO), endrin (ISO), heptachlor (ISO) or mirex (ISO)kgfreefreefreefree
3824.858-- Containing 1,2,3,4,5,6-hexachlorocyclohexane (HCH (ISO)), including lindane (ISO, INN)kgfreefreefreefree
3824.864-- Containing pentachlorobenzene (ISO) or hexachlorobenzene (ISO)kgfreefreefreefree
3824.870-- Containing perfluorooctane sulphonic acid, its salts, perfluorooctane sulphonamides, or perfluorooctane sulphonyl fluoridekgfreefreefreefree
3824.887-- Containing tetra-, penta-, hexa- hepta- or octabromodiphenyl etherskgfreefreefreefree
3824.9- Other:
3824.917-- Mixtures and preparations consisting mainly of (5-ethyl-2-methyl-2- oxido-1,3,2-dioxaphosphinan-5-yl)methyl methyl methylphosphonate and bis((5-ethyl-2-methyl-2-oxido-1,3,2- dioxaphosphinan-5- yl)methyl) methylphosphonatekgfreefreefreefree
3824.99-- Other:
3824.99.1--- Mixtures of hydrocarbons and lubricity agents:
3824.99.113---- In aerosol containerskg0,183c/lifreefreefree
3824.99.199---- Otherkg0,183c/lifreefreefree
3824.99.2--- Flotation reagents containing dicresyldithiophosphoric acid or alkyl dithiophosphates:
3824.99.210---- In aerosol containerskg10%freefreefree
3824.99.296---- Otherkg10%freefreefree
3824.99.3--- Mono-, di- and triesters of glycerol with unmodified fatty acids, with a soap content (calculated as sodium stearate), by mass, of 3,5 per cent or more and a 1- monoglyceride content, by mass, not exceeding 38 per cent:
3824.99.318---- In aerosol containerskg10%freefreefree
3824.99.393---- Otherkg10%freefreefree
3824.99.4--- Mono-, di- and triesters of glycerol with a soap content (calculated as sodium stearate), by mass, of less than 3,5 per cent and a 1-monoglyceride content, by mass, not exceeding 45 per cent:
3824.99.415---- In aerosol containerskgfreefreefreefree
3824.99.490---- Otherkgfreefreefreefree
3824.99.5--- Phthalic acid esters of mixed aliphatic alcohols:
3824.99.512---- In aerosol containerskgfreefreefreefree
3824.99.598---- Otherkgfreefreefreefree
3824.99.6--- Preparations put up as correction fluids:
3824.99.618---- In aerosol containerskgfreefreefreefree
3824.99.695---- Otherkgfreefreefreefree
3824.99.7--- Chlorinated paraffins:
3824.99.717---- In aerosol containerskg10%freefreefree
3824.99.792---- Otherkg10%freefreefree
3824.99.8--- Other mixtures consisting mainly of chemicals containing a phosphorus atom to which is bonded one methyl, ethyl, n-propyl or isopropyl group but not further carbon atoms:
3824.99.814---- In aerosol containerskgfreefreefreefree
3824.99.896---- Otherkgfreefreefreefree
3824.99.9--- Other:
3824.99.911---- In aerosol containerskgfreefreefreefree
3824.99.997---- Otherkgfreefreefreefree
38.25Residual products of the chemical or allied industries, not elsewhere specified or included; municipal waste; sewage sludge; other wastes specified in Note 6 to this Chapter:
3825.108- Municipal wastekgfreefreefreefree
3825.202- Sewage sludgekgfreefreefreefree
3825.307- Clinical wastekgfreefreefreefree
3825.4- Waste organic solvents:
3825.418-- Halogenatedkgfreefreefreefree
3825.499-- Otherkgfreefreefreefree
3825.506- Wastes of metal pickling liquors, hydraulic fluids, brake fluids and anti-freeze fluidskgfreefreefreefree
3825.6- Other wastes from chemical or allied industries:
3825.617-- Mainly containing organic constituentskgfreefreefreefree
3825.698-- Otherkgfreefreefreefree
3825.904- Otherkgfreefreefreefree
3826.00Biodiesel and mixtures thereof, not containing or containing less than 70 per cent by weight of petroleum oils or oils obtained from bituminous minerals:
3826.00.104- Biodiesel as defined in Additional Note 1(a) to Chapter 38kg0,183c/lifreefreefree
3826.00.902- Otherkg0,183c/lifreefreefree

Disclaimer: Information is provided as a free service and is for reference purposes only. It does not constitute the provision of professional advice of any kind. No responsibility for any loss caused to any person acting or refraining from action as a result of any material in this publication can be accepted by the author, copyright owner or publisher. Tariff information should be confirmed with SARS.

Tariff Book (S1 P1)

Browse by Tariff Headings
  • © Now Media
  • Privacy Policy
  • Freight News RSS
  • About Us
  • Advertise
  • Send us news
  • Contact us